Dr Smood SoHo: Your Destination for Organic, Healthy Eats in NYC

Dr Smood Introduce

In the vibrant and trendy neighborhood of SoHo, where fashion and art converge, there’s a place dedicated to a different kind of style: a healthy lifestyle. Dr Smood, located at 470 Broome Street, is more than just a juice shop. It's a holistic wellness cafe that has made a name for itself by providing a carefully crafted menu of organic, unprocessed, and delicious foods and beverages. Stepping inside, you're greeted by a clean, modern, and inviting atmosphere, designed to feel both comfortable and upmarket. It's a space that encourages you to slow down and enjoy a healthy meal, whether you're starting your day with a nutrient-packed breakfast or seeking a revitalizing pick-me-up in the afternoon.

Dr Smood's mission is to offer "Smart Food for a Good Mood," and they deliver on this promise through a menu that is as thoughtful as it is tasty. Their offerings are rooted in the belief that food is medicine, with each item designed to support optimal performance for the body and mind. The menu is a playground of healthy options, from vibrant "Live Smoodys" to wholesome wraps, toasts, and salads. What sets them apart is their dedication to using only organic, non-GMO, and unprocessed ingredients, ensuring that every bite and sip contributes positively to your well-being. This commitment to quality and health has made Dr Smood a favorite among health-conscious New Yorkers, offering a much-needed sanctuary of clean eating amidst the city's fast-paced energy. Whether you're a local seeking a consistent source of healthy food or a visitor looking to refuel, Dr Smood offers an experience that is both nourishing and enjoyable.

Situated in the heart of SoHo at 470 Broome Street, Dr Smood enjoys a prime location that is both fashionable and easily accessible. The cafe is nestled among designer boutiques, art galleries, and other popular establishments, making it a perfect spot to stop for a quick bite or a relaxing break while exploring the neighborhood. The area is well-connected by public transportation, providing a hassle-free journey for New Yorkers coming from any part of the city. The nearest subway stations are the A, C, and E lines at Canal Street, and the N, Q, R, W, J, and Z lines at Canal Street, all just a short and pleasant walk away. This accessibility makes it convenient for daily commuters, office workers, and tourists alike.

The cafe’s physical layout is also designed with accessibility in mind. Dr Smood features a wheelchair-accessible entrance, seating, and gender-neutral toilets, ensuring that all guests can navigate the space with ease and comfort. For those who enjoy dining al fresco, the cafe also offers outdoor seating, a great option for people-watching and soaking up the lively SoHo atmosphere. While parking in SoHo can be a challenge, the excellent public transit and the pedestrian-friendly nature of the neighborhood make Dr Smood a destination that's easy to reach and well worth the visit.

Dr Smood provides a range of services designed to accommodate various dining preferences and schedules, making it a versatile and customer-friendly establishment. These services go beyond a simple dine-in experience, offering convenience and flexibility. The key services include:

Dine-in: The cafe provides a comfortable and casual setting for patrons who wish to enjoy their food and drinks on-site. The seating and atmosphere are perfect for a relaxed meal or a work session.
Takeaway and Delivery: For those on the go or who prefer to eat at home or the office, Dr Smood offers efficient takeaway and delivery services, ensuring their healthy meals are always within reach. They also offer no-contact delivery for added safety and convenience.
Catering: Dr Smood provides catering services, offering a fantastic option for meetings, events, and parties where you want to provide healthy, organic food options.
Wi-Fi: The cafe offers free Wi-Fi, making it a great spot for remote workers or students looking for a peaceful and productive environment.
Dining Options: The menu is structured to cover various dining occasions, including breakfast, lunch, and dessert, with a wide array of options to satisfy different cravings at any time of day.

These services highlight Dr Smood’s commitment to being a convenient and reliable source of healthy food and drinks for the community.

What sets Dr Smood apart from other cafes and juice shops are its unique features and highlights, which are a direct reflection of its brand philosophy. These elements contribute to a holistic and enjoyable experience. Key highlights include:

Organic and Healthy Offerings: Every item on the menu is organic, and many are vegetarian, vegan, and gluten-free, catering to a wide range of dietary needs and preferences. Their commitment to clean eating is unparalleled.
Live Music: The presence of live music adds a unique and engaging element to the cafe's atmosphere, creating a more dynamic and entertaining environment for customers to relax and enjoy their visit.
"Live Smoodys" and Signature Brews: Their smoothie and juice menu, featuring drinks like the Green Protein and Cacao Protein, is a major draw. Their signature brews, such as the Lavender Blueberry Matcha Latte, offer unique and flavorful alternatives to standard coffee.
Focus on "Performance Foods": The menu is designed to provide functional benefits. Whether you're looking for an energy boost, improved focus, or a detoxifying drink, there's a product scientifically crafted to help.
High-Quality Coffee: Beyond the juices and smoothies, Dr Smood is known for its high-quality coffee, including Americanos, Lattes, and Cold Brews, all made with organic beans.
Family-Friendly Environment: The cafe is well-suited for families, with a casual atmosphere and options that are good for kids, making it a welcoming place for everyone.

These features underscore Dr Smood’s mission to be a leader in the healthy food and lifestyle space in New York City.

For those looking to visit or contact this location, here is the essential information:

Address: 470 Broome St, New York, NY 10013, USA

Phone: (646) 713-1376

Mobile Phone: +1 646-713-1376

In a city where healthy food options can often be a challenge to find, Dr Smood stands out as a reliable and high-quality choice. What makes it particularly worth choosing is its unwavering commitment to organic, unprocessed ingredients and its comprehensive, thoughtfully curated menu. While some may find the prices on the higher end, as one reviewer noted, the quality and health benefits justify the cost. The food, from the "special avocado toast" to the wraps and salads, is not only healthy but also remarkably tasty. The ambiance is another significant draw; the quiet music, comfortable seating, and chic floor design create a calm and pleasant escape from the busy city streets. The cafe’s versatility, offering everything from sit-down meals to quick takeaways and even catering, makes it a perfect fit for a variety of needs. Whether you are a local seeking a regular source of clean food, a student looking for a place to work, or a tourist needing a healthy meal, Dr Smood delivers on its promise of smart food for a good mood. It's a place where you can invest in your health without compromising on taste or atmosphere.

Dr Smood Food & drink

Wraps
Spicy Tuna Wrap US$15.95
wheat tortilla, pole caught tuna, dill, vegan mayo, himalayan salt, jalapeños, spinach, radicchio, rainbow carrots, apple. Side salad not included.
Chicken Vegetable Wrap US$16.95
wheat tortilla, chicken breast, avocado, hummus, spinach, red pepper, red onions, vegan mayo. Side salad not included.

Live Smoodys
Strawberry Banana US$13.95
Oat mylk, strawberry, banana, coconut probiotic yogurt, date, coconut syrup, topped with goji berries.
Cacao Protein US$13.95
Almond mylk, banana, cacao protein mix (pea protein, hemp, cacao), almond butter, date paste. 25g of protein.
Vanilla Cinnamon Banana US$15.95
made with Dr Smood Smart Meal, almond mylk, banana.
Green Protein US$13.95
Almond mylk, avocado, kale, spinach, banana, moringa, maca, plant protein powder, raw honey, topped with ginger nut crumble. 21g of protein.

Breakfast
Smood Yogurt US$12.95
coconut yogurt, berry jam, almond butter, gluten-free granola, honey
Matcha + Maca Chia Pudding US$7.95
Chia seeds, almond mylk, cashew, maca, lucuma, matcha, coconut palm sugar, vanilla, himalayan salt, topping.
Hummus & Bread US$13.95
hummus, chickpeas, paprika, extra virgin olive oil w/ wheat sourdough
Raw Oats W/ Berry Jam US$8.95
Almond milk, rolled oats, banana, date, strawberries, blueberries, blackberries, lemon, honey. Non-customizable.

Performance Products
Smart Meal - Vanilla Cinnamon, 14pack US$96.00
Drip Coffee (12oz Bag) US$21.95
Organic medium roasted coffee beans from Chiapas, Mexico. The beans carry flavor notes of baked apple, chocolate, and almond with a medium body and a delicate acidity level. 12oz.
Smart Snack Lemon Caramel, 1ct US$3.50
Smart Snack Cookie Dough, 1ct US$3.50
Smart Meal - Vanilla Cinnamon Sachet US$6.95
Smart Snack Cinnamon Bun, 1ct US$3.50
Espresso Coffee (12oz Bag) US$21.95
Organic medium-dark roasted coffee beans from Chiapas, Mexico. The beans carry flavor notes of baked apple, chocolate, and almond with a medium body and a delicate acidity level. 12oz.
Smart Snack Cinnamon Bun, 12ct US$42.00
Smart Snack Peanut Butter Cup, 1ct US$3.50
Smart Snack Peanut Butter Cup, 12ct US$42.00
Smart Snack Lemon Caramel, 12ct US$42.00
Smart Snack Cookie Dough, 12ct US$42.00

Coffee
Americano 10oz US$4.50
Espresso, hot water.
Latte 10oz US$5.50
Espresso, your choice of steamed mylk.
Latte Iced 16oz US$6.50
Espresso, your choice of iced mylk.
Cold Brew Coffee 16oz US$5.50
Cold brewed coffee, iced.
Cappucino 16oz US$6.50
Espresso, your choice of foamed mylk.
Cortado US$4.25
Espresso, your choice of steamed mylk.
Cold Brew Coffee 12oz US$4.50
Cold brewed coffee, iced.
Americano Iced 16oz US$5.50
Espresso, iced water.
Macchiato US$3.75
Espresso, your choice of mylk.
Cappuccino 10oz US$5.50
Espresso, your choice of foamed mylk.
Americano 16oz US$5.50
Espresso, hot water.
Espresso US$3.00
Double shot espresso.
Latte 16oz US$6.50
Espresso, your choice of steamed mylk.

Sandwiches & Toasts
Wild Salmon Toast US$16.95
sourdough, smoked wild salmon, organic cream cheese, cucumber, red onion, capers, herbs (arugula, dill, parsley), lemon
The Avocado Toast Large US$14.95
Avocado, olive oil, Himalayan salt, black pepper.
Oliver's Turkey Sandwich US$16.95
sourdough, turkey, avocado, tomato, red pesto
Smood Tuna Melt Sandwich US$16.95
sourdough, pole caught tuna, vegan mayo, dill, tomato, cheddar cheese
Vegan Sandwich US$15.95
Sourdough, avocado, hummus, spinach, tomato, red pesto, himalayan salt, black pepper.
Rocket Chicken Sandwich US$16.95
Rocket Chicken mix (chicken breast, vegan mayo, dijon mustard, green onions, celery, Himalayan salt and pepper), arugula on sourdough. Ingredients cannot be removed from mix.
Protein Avocado Toast Large US$16.95
Avocado, olive oil, hummus, cucumber, chili flakes, Himalayan salt, black pepper.

Signature Brews
Matcha Latte 16oz US$7.50
Ceremonial stone ground Matcha with your choice of mylk.
Hot Cacao 10oz US$5.50
Cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt.
Raw Mocha 16oz US$6.95
Espresso, cacao syrup (cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt) and your choice of mylk.
Lavender Blueberry Matcha Latte 16oz US$8.95
Ceremonial Matcha, Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk, Oat Mylk recommended.
Matcha Latte 10oz US$5.50
Ceremonial stone ground Matcha with your choice of mylk.
Raw Mocha 10oz US$5.95
Espresso, cacao syrup (cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt) and your choice of mylk.
Hot Cacao 16oz US$6.50
Cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt.
Lavender Blueberry Latte 16oz US$7.50
Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk.
Matcha Tea 10oz US$3.75
Dr Smood’s own ceremonial stone ground green tea
Lavender Blueberry Matcha Latte 10oz US$7.50
Ceremonial Matcha, Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk, Oat Mylk recommended.
Lavender Blueberry Latte Iced 16oz US$7.50
Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk.
Matcha Tea 16oz US$4.50
Dr Smood’s own ceremonial stone ground green tea.
Lavender Blueberry Matcha Latte Iced 16oz US$8.95
Ceremonial Matcha, Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk, Oat Mylk recommended.
Lavender Blueberry Latte 10oz US$5.50
Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk.
Matcha Tea Iced 16oz US$4.50
Dr Smood’s own ceremonial stone ground green tea.
Raw Mocha Iced 16oz US$6.95
Espresso, cacao syrup (cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt) and your choice of mylk.
Matcha Latte Iced 16oz US$7.50
Ceremonial stone ground Matcha with your choice of mylk

Promotions
Latte & Pastry Bundle US$10.95
Pair one of our artisanal pastries with your favorite latte.
Dr Smood Classic Bundle US$16.95
The Avocado Toast Large + Cold Brew Coffee 12oz. No substitutions.

Soups
Gazpacho Soup 12oz US$15.95
Tomatoes, red bell pepper, onion, cucumber, sunflower oil, red wine vinegar, Himalayan salt, with a side of croutons.
Butternut Squash Soup 8oz US$9.95
Butternut squash, onion, sunflower oil, sweet potato, carrot, tomato, bay leaf, garlic, nutritional yeast, Himalayan salt, with a side of bread.
Tomato Soup 8oz US$9.95
Tomato, onion, celery, carrot, basil, olive oil, sunflower oil, bay leave, Himalayan salt, with a side of bread.
Tomato Soup 12oz US$11.95
Tomato, onion, celery, carrot, basil, olive oil, sunflower oil, bay leave, Himalayan salt, with a side of bread.
Gazpacho Soup 8oz US$12.95
Tomatoes, red bell pepper, onion, cucumber, sunflower oil, red wine vinegar, Himalayan salt, with a side of croutons.
Butternut Squash Soup 12oz US$11.95
Butternut squash, onion, sunflower oil, sweet potato, carrot, tomato, bay leaf, garlic, nutritional yeast, Himalayan salt, with a side of bread.

Bowls & Salads
Classic Caesar Salad US$14.95
Romaine lettuce, radish, parmesan cheese, herb croutons, caesar dressing (vegan mayo, parmesan cheese, lemon, Himalayan salt, black pepper).
The Smood Greek Salad US$16.95
Arugula, chickpeas, feta, olives, grape tomato, red onion, cucumbers, lemon garlic mustard vinaigrette.

Waters & Infusions
Alkaline Water US$3.50
Awarded best tasting alkaline water in the world! 16oz.

Sides
Salmon (Smoked) US$8.95
Almond Butter US$3.95
Red Pesto US$3.95
Cream Cheese US$3.00
Signature Hot Sauce US$2.00
Whole Milk 2oz US$1.00
Lemon Wedges (2) US$1.00
Radish US$2.00
Cucumber US$2.00
Hummus US$3.00
Coconut Yogurt 5oz US$4.95
Feta Cheese US$3.95
Fresh Jalapeños US$2.00
Organic Vanilla Syrup US$1.50
Parmesan Caesar Dressing US$2.00
Red Onions US$1.00
Grape Tomatoes US$3.95
Avocado US$3.95
Cheddar Cheese US$2.00
Kalamata Olives US$4.95
Romaine Lettuce US$2.00
Vegan Mayo US$2.00
Arugula US$2.00
Spinach US$2.00
Mustard Lemon Vinaigrette US$2.00
Tuna US$5.95
Wild pole caught tuna, vegan mayo, dill.
Rocket Chicken Side US$9.95
chicken breast, vegan mayo, dijon mustard, celery, green onions, salt and pepper.
Almond Butter Granola US$4.00
Banana US$2.00
Capers US$2.00
Chickpeas US$2.00
Whole Wheat Sourdough Side (2 Slices) US$2.00
Tortilla Wrap US$2.00
Turkey US$6.95
Rainbow Carrots US$3.95
Bread - Performance US$3.95
Roasted Peppers US$3.95
Chicken Breast US$8.95
Strawberry US$2.95

MOSS Beverages
Moss Mango US$4.95
Reverse osmosis water, wild sea moss, mango, lime, ginger, monk fruit, erythritol (from non-gmo pears and apples).
Moss Pure US$4.95
Reverse osmosis water, wild sea moss, lime, monk fruit, erythritol (from non-gmo pears and apples).
Moss Pomegranate US$4.95
Reverse osmosis water, wild sea moss, pomegranate, black currant, hibiscus, tarragon, orange, monk fruit. erythritol (from non-gmo pears and apples).

Teas
Herbal Tea 16oz US$3.75
Blackberry, ginger, fennel, cat's claw, honey bush, pai mu tan (caffeine free).
Detox Roots Tea Iced 16oz US$3.75
Ginger, turmeric, licorice, nutmeg, black pepper and cloves.
Detox Roots Tea 16oz US$3.75
Ginger, turmeric, licorice, nutmeg, black pepper and cloves.
Queen Of Earl Tea Iced 16oz US$3.75
Ceylon black tea, italian bergamot, molasses.
Queen Of Earl Tea 16oz US$3.75
Ceylon black tea, italian bergamot, molasses.
Herbal Tea Iced 16oz US$3.75
Blackberry, ginger, fennel, cat's claw, honey bush, pai mu tan (caffeine free).
White Ginger Tea 16oz US$3.75
Fujian white tea, pomegranate, ginger.
White Ginger Tea Iced 16oz US$3.75
Fujian white tea, pomegranate, ginger.

Bakery
Pumpkin Spice Loaf US$6.95
Vegan, gluten free, no refined sugar.
Blueberry Almond Loaf US$6.95
Vegan, gluten free, no refined sugar.
Cranberry Almond Cookie US$6.95
Vegan, gluten free, no refined sugar.
Chocolate Chip Cookie US$6.95
Vegan, gluten free, no refined sugar.

Dr Smood Details

Service options
Outdoor seating
No-contact delivery
Delivery
Takeaway
Dine-in

Highlights
Live music

Accessibility
Wheelchair-accessible entrance
Wheelchair-accessible seating
Wheelchair-accessible toilet

Offerings
Coffee
Organic dishes
Vegetarian options

Dining options
Breakfast
Lunch
Catering
Dessert
Seating

Amenities
Gender-neutral toilets
Toilet
Wi-Fi
Wi-Fi

Crowd
Family friendly

Payments
Debit cards
NFC mobile payments
Credit cards

Children
Good for kids

Dr Smood Photos

Dr Smood Location

Dr Smood

New York New York County New York Broome Street

470 Broome St, New York, NY 10013, USA

Dr Smood Reviews

An average rating of ★3.6 from 278 user reviews.

coffeepricesandwichveganmilkmatchaavocado toastatmospherestaringredients

★ 5★ 4★ 3★ 2★ 1

Wow! Tasty, healthy, food at a fair price (for New York!). I was full with just the special avocado toast. We also enjoyed the vibe of the place with quiet music and plenty of seating.Tip: happy hour from 4 to 6 pm means a discount on their healthy drinks.
April 12 · Louis Shaffer
Not a fan.My kale salad was just a plate of bare kale, with some tomatoes and chicken on top.Nothing special.3/4 available tables were dirty.Ambiance was nice, the floor is really cool!All things considered: Would not recommend.
August 16 · Diederio
A nice place for a seated coffee and breakfast in a serene environment. Or a quick catchup with a friend in Soho - they have lots of space.Extra credit: they make their own plant based milks.However they mixed up my order and I had to have my matcha latte with oat milk instead of coconut. I gave it a shot but I did not like the dates flavor which I guess they add to their oat milk as a sweatener.
November 28 · HANE Xxxx
Omnivore here. Certainly not a vegan. Grabbed a smoody aka refreshing cold summer tasty drink with a friend. Did not know you could combine mango and ginger into a blast of deliciousness. 5/5 will be back for smoodies, friend's avocado salmon dish looked pretty good too. Seating outside looks like good option in summer afternoon.
April 24 · Bo
For the price, you want a consistent product at the VERY least. And beyond that, you want consistent service. They are frequently understaffed and often times the staff are rude! They seem quite bothered to be working there. When the product is as intended it’s great, but that’s about 50% of the time.My first review: (4 stars)This smoothie changed my life. I thought smood was great, delicious, cool space, nice service.
June 02 · Frances