Goloso Restaurant Introduce
Introduction / Overview
In the vibrant culinary landscape of New York, finding a restaurant that offers a genuine taste of a specific culture is a treat, and Goloso Restaurant in Yonkers stands out as a true Dominican gem. Located at 272 Riverdale Ave, this restaurant has become a go-to spot for locals seeking authentic and flavorful Dominican comfort food. The menu is a comprehensive tour of traditional dishes, from a hearty breakfast to full-blown dinner platters. It's a place where you can find everything from the classic "Tres Golpes" to the popular "Fritura Mix," ensuring there's something to satisfy every craving. Goloso Restaurant has built a reputation for being a great option for any meal of the day, whether you're starting your morning with a flavorful Dominican breakfast, grabbing a quick lunch, or settling in for a satisfying dinner. The atmosphere is casual and cozy, making it a comfortable place for solo diners or groups to enjoy a meal. While the restaurant has faced some criticisms regarding food temperature and service in specific instances, its popularity and high volume of orders suggest that these are occasional issues rather than the norm. Patrons frequently mention the generous portions and authentic flavors, which keep them coming back for more. Goloso Restaurant is not just a place to eat; it’s a place to experience the rich and diverse culinary traditions of the Dominican Republic right here in Yonkers.
Location and Accessibility
Goloso Restaurant is conveniently located at 272 Riverdale Ave, Yonkers, NY 10705, USA. This address places it in a bustling part of Yonkers, making it a practical and easy destination to reach for local residents. The restaurant provides a great option for those living or working nearby who are looking for a quick and satisfying meal. While the prompt doesn't specify parking, its location on a main avenue suggests that both street parking and nearby lots are likely available, as is common in the area. The restaurant’s service options, including delivery and takeout, also enhance its accessibility, allowing customers to enjoy its offerings without having to visit the physical location. For those who do choose to dine in, the casual and cozy atmosphere provides a welcoming environment to sit down and enjoy a meal at their own pace.
Services Offered
- Delivery: Have your favorite Dominican dishes delivered directly to your home for a convenient meal.
- Takeout: Place an order and pick it up to enjoy on the go.
- Dine-in: Sit down and enjoy the casual and cozy atmosphere for a relaxed meal.
Features / Highlights
- Serves authentic Dominican cuisine: The menu is a testament to the rich culinary traditions of the Dominican Republic, offering a wide range of traditional dishes.
- Offers a variety of meals: Goloso Restaurant is a popular spot for breakfast, lunch, and dinner, catering to all times of the day.
- Known for comfort food: The menu is filled with hearty and satisfying dishes that are perfect for a cozy meal.
- Offers quick bites and small plates: The menu includes a variety of smaller items like empanadas, tequeños, and yoyos, perfect for a snack or an appetizer.
- Good for solo diners and groups: The casual atmosphere is suitable for a quick meal by yourself or a gathering with friends.
- Accepts various payments: The restaurant accepts credit cards, debit cards, and NFC mobile payments, providing flexible payment options.
- Good for kids: The restaurant offers a welcoming environment for families with children.
Contact Information
Address: 272 Riverdale Ave, Yonkers, NY 10705, USA
Phone: (914) 349-9300
What is worth choosing
When it comes to Goloso Restaurant, what makes it a worthy choice for any New Yorker is its commitment to authentic Dominican flavors and a menu that is as extensive as it is delicious. The restaurant's menu offers a deep dive into Dominican cuisine, providing an experience that goes beyond the ordinary. The lunch specials, like the "Roasted Pork (Pernil) Special" and "Beef Stew Special," are a great value, offering a satisfying and filling meal. For a true taste of a classic Dominican breakfast, the "Tres Golpes" is a must-try, combining mashed plantain with a mix of fried eggs, salami, and cheese. The variety of empanadas, from "Empanada De Pollo" to "Empanada Pizza," offers a quick and tasty option. The "Fritura Mix," available in different sizes, is a popular choice for sharing and a perfect introduction to the various fried meats and sides that are central to Dominican cuisine. While some customer reviews have mentioned issues with food temperature and specific orders, these seem to be isolated incidents, and the sheer volume of positive feedback on food quality and flavor suggests these are not the norm. For instance, a customer who had an issue with an allergen was still given the option to have a new dish made, showing a willingness to resolve problems. The natural juices, such as "Jugo Morir Soñando" and "Jugo De Chinola," are a refreshing and authentic complement to any meal. Whether you’re craving a hearty meal, a quick snack, or a sweet dessert like "Tres Leches Cake," Goloso Restaurant has a wide-ranging menu that makes it a top choice for anyone in Yonkers looking for a delicious and genuine taste of the Dominican Republic.
Goloso Restaurant Menu
All Day - Desserts
- Tres Leches Cake $5.50
A sponge cake soaked in three types of milk, topped with whipped cream, colorful sprinkles, and a cherry.
- Habichuelas Con Dulce $6.75
Sweet creamed beans with coconut milk, cinnamon, and cloves, topped with sliced sweet potatoes.
- Chocolate Cake $5.20
Rich chocolate layers with smooth, creamy chocolate frosting.
- Carrot Cake / Zanahoria $4.75
Bizcocho de zanahoria.
- Arroz Con Leches $3.90
Creamy rice pudding topped with raisins.
All Day - Breakfast
- Tres Golpes $13.00
Egg, salami and cheese with choice of mangu, mashed yautia, smashed sweet plantains, banana or cassava.
All Day - Foot Long Dogs (More Coming)
- Dominican Dog $14.99
Foot long!!! Grilled all-natural smoked beef dog on a brioche bun. Cabbage, ground beef, white onion, corn, cheese sauce, potato sticks, ketchup and mayo.
All Day - Patacon
- Patacon $14.00
Patacon is a sandwich made out of green plantains, with choice of protein, lettuce, tomatoes, and ketchup mayo sauce.
All Day - Mofonguitos
- Mofonguitos $14.00
3 mofonguitos made out of plantains, protein of choice, cheese. With pico de gallo and ketchup mayo sauce.
All Day - Empanadas
- Empanada Queso Blanco $3.00
Crispy pastry filled with melted white cheese, served with a side of creamy dipping sauce.
- Empanada De Pollo $3.00
Crispy pastry filled with seasoned shredded chicken, served with a side of creamy dipping sauce.
- Empanada De Pollo Queso $3.00
Crispy pastry filled with shredded chicken and melted cheese, served with a creamy dipping sauce.
- Tequeño $2.50
- Quipe $3.00
Ground beef mixed with bulgur wheat, seasoned with Latin spices, and deep-fried to a crispy golden brown. Served with a side of creamy dipping sauce.
- Empanada De Carne Y Queso $3.00
Golden pastry filled with seasoned ground beef and melted cheese.
- Empanada Jamon Y Queso $3.00
Golden crispy pastry filled with savory ham and melted cheese.
- Bola De Yuca $2.50
Crispy yuca empanada filled with seasoned meat, served with a side of creamy dipping sauce.
- Empanada Pizza $3.00
Crispy pastry filled with melted cheese and savory tomato sauce, served with a side of creamy dipping sauce.
- Bola De Papa $2.50
Crispy potato ball filled with seasoned meat, served with a side of creamy dipping sauce.
- Empanada De Carne $3.00
Golden pastry filled with seasoned ground beef, offering a savory blend of spices and tender meat.
- Empanada De Pollo Queso Y Maiz $3.00
Chicken with corn empanada.
- Empanada Queso Amarillo $3.00
Golden pastry filled with melted yellow cheese.
All Day - Lunch Specials
- Roasted Pork (Pernil) Special $14.00
Served with rice and beans.
- Baked Chicken Special $12.99
Quarter chicken served with rice and beans.
- Beef Stew Special $14.00
Served with rice and beans.
- Stew Chicken Special $12.99
Served with rice and beans.
- Baked Pork Ribs Special / Costillas $14.00
Typically includes tender baked pork ribs, often accompanied by traditional Latin-American sides like rice, beans, and salad.
- Stew Pork Chop Special / Chuleta $14.00
Slow-cooked pork chop typically served with rice, beans, and a fresh green salad.
All Day - Jugos Naturales
- Jugo De Chinola (Parcha) $5.50
Passion fruit juice. Choice of 16 oz, 20 oz, or 32 oz.
- Jugo Morir Soñando $5.90
Creamy citrus juice, available in 16, 20, or 32 ounces.
- Avena Chinola $5.20
Creamy passion fruit oat drink, available in 16, 20, or 32 ounces.
- Limonada $5.20
Refreshing lemonade. Available in 16 oz, 20 oz, or 32 oz sizes.
- Avena Limón $5.20
Creamy oatmeal with a hint of lemon juice. Available in 16, 20, or 32 ounces.
- Jugo De Tamarindo $5.85
All Day - Fritura
- Fritura Mix 1 Persona $18.00
A combination of golden fried plantains, crispy pork chunks, savory sausages, and a slice of lime.
- Bandeja Fritura Mixta $46.99
All Day - The Boring Menu
- Tacos Dorados $15.00
Tacos dorados with Hot Cheetos flavored top, our melted cheese, chicken, sour cream, mozzarella cheese, and lettuce.
All Day - Chimichanga
- Chimichanga $15.60
A delicious fried burrito.
All Day - Burritos
- Burrito $15.60
A combination of pico de gallo, rice, beans, sour cream, cheese, and your meat of choice, put together on a tortilla.
All Day - Quesadilla
- Quesadilla $13.99
Warm and crisp flour tortilla with sour cream. Protein mixed with Cheddar and mozzarella cheese, and pico de gallo (onions & tomatoes).
All Day - Sandwiches
- Chimi De Pollo $13.00
Grilled chicken sandwich with shredded cabbage, tomatoes, and a tangy sauce, served on a toasted bun.
- Cuban Sandwich $13.00
- Rikitaki $13.00
A traditional Dominican sandwich with ground beef, eggs, cabbage, tomatoes, onions, and our sauce.
- Bacon, Egg & Cheese $6.50
On a delicious, sweet brioche bun.
All Day - Yoyos
- Yoyo $14.30
Yoyo is sandwich, made out of sweet plantains, with choice of protein, fried cheese, lettuce, tomatoes, and ketchup mayo sauce.
All Day - Frituras
- Chicharrón De Cerdo $9.50
Crispy pork bites. Available in half-pound or one pound portions.
- Chicharrón De Pollo $9.50
Chicken chunks boneless.
- Longaniza $9.50
Spicy Latin-American sausage. Available in half-pound or full-pound portions.
- Oreja $9.50
Crispy pig ear strips. Choice of half pound or full pound.
- Carnita De Res $9.50
Tender beef "carnitas" served in half-pound or full-pound portions.
- Morcilla $9.50
Blood sausage. Size options: half pound or pound.
- Chicken Wings $9.50
Choice of small or large order. Available plain, Buffalo, or BBQ.
All Day - Cachapas
- Cachapa $14.30
Sweet corn pancake, with choice of protein, cheese, lettuce, and tomatoes. Ketchup and mayo sauce.
All Day - Salchipapa
- Salchipapa $13.00
Salchipapa Crispy fries topped with sliced sausage. Available in Small or Large size.
All Day - Yaroas
- Yaroa De Papa $13.00
- Yaroa De Plátano $14.00
All Day - Combos
- Combo 9 (Chicharrón De Pollo Sin Hueso) $35.09
Chicken chunks, rice, beans, sweet plantains, salad, and two-liter soda.
- Combo 4 $14.75
5 empanadas a elegir y una Coca-Cola (20 onzas).
- Combo 8 (Whole Chicken) $32.50
Rotisserie chicken, rice, beans, sweet plantains, salad, and two-liter soda.
- Combo 6 $9.25
3 empanadas y una Coca-Cola (20 onzas).
- Combo 3 (Pernil) $29.95
Roasted pork, rice, beans, sweet plantains, salad, and two-liter soda.
- Combo 11 (Res Guisado) $29.99
Beef stew, rice, beans, sweet plantains, salad, and two-liter soda.
- Combo 10 (Chicken Wings) $36.00
Chicken wings, rice, beans, sweet plantains, salad, and two-liter soda.
- Combo 7 $22.50
8 empanadas and a 2-liter Coke.
- Combo 5 (Chuleta) $36.00
Pork chops, rice, beans, sweet plantains, salad, and two-liter soda.
All Day - Supremes
- Nacho Supreme $13.00
Nachos with cheese, choice of protein, beans, pico de gallo, ketchup mayo sauce.
- Papa Supreme $13.00
Fries with cheese, choice of protein, pico de gallo, ketchup mayo sauce.
All Day - Servicios
- Tostones $5.50
Crispy plantain slices. Available in small or large sizes.
- French Fries $4.00
Crispy French fries available in small, medium, or large sizes.
- Yuca $5.50
Cassava (yuca). Choice of Small or Large size.
- Guineitos $5.50
Green bananas served in either small or large size.
- Yuca Frita $6.50
Crispy fried cassava sticks, garnished with fresh cilantro, served with a side of creamy dipping sauce.
All Day - Bebidas
- Soda Lata $2.00
Choices of soda in a can: Canada Dry, Coca-Cola, orange, Pepsi, Sprite, grape.
- Doble Litros $5.00
Two-liter sodas: Canadá Dry, Coca-Cola, Pepsi, Rojo Country Club, Sprite, Uva.
- Snapple $2.50
Raspberry tea with natural flavors and a refreshing, fruity taste.
- Water $1.50
Water bottle.
All Day - Porciones
- Porción De Arroz $4.00
Rice: Available in small, medium, or large portion sizes.
- Habichuelas $2.00
Beans, choice of medium or small size.
- Arroz Moro $4.50
A side of mixed black beans and white rice. Sizes: small, medium, large.
All Day - Ensaladas
- Ensalada Verde $4.50
Green salad. Options: small or large.
- Ensalada De Papa Con Zanahoria $6.00
Potato and carrot salad with your choice of size: small or large.
All Day - American Breakfast
- Bacon, Egg And Cheese On A Roll $5.50
Bacon, egg, and cheese on a roll: Bacon, egg, and cheese typically on a soft roll, creating a classic breakfast sandwich.
- Ham, Egg And Cheese On A Roll $5.50
Ham, egg, and cheese on a roll: Scrambled eggs, ham, and American cheese on a soft roll.
- Ham And Cheese Sandwich On A Roll $5.50
Ham and American cheese on a fresh roll, typically includes lettuce, tomato, and mayonnaise.
Goloso Restaurant Details
Service options
- Delivery
- Takeout
- Dine-in
Popular for
- Breakfast
- Lunch
- Dinner
- Solo dining
Offerings
- Coffee
- Comfort food
- Quick bite
- Small plates
Dining options
- Breakfast
- Lunch
- Dinner
- Dessert
Atmosphere
- Casual
- Cozy
Planning
- Accepts reservations
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
Goloso Restaurant Photos










Goloso Restaurant Location
Goloso Restaurant
272 Riverdale Ave, Yonkers, NY 10705, USA
Goloso Restaurant Reviews
empanadaspricescachapadeliverywindowdollarsyaroapink saucefryerboyfriend
★ 5★ 4★ 3★ 2★ 1So I came to this place to try their $6 2 piece chicken and fries deal, the fries are decent but cold! The chicken was cold by the time I got home which is walkable distance. Everything was stone cold. I’m pretty sure when they put it in the box, It was cold because it wasn’t even lukewarm at al any of it, so even for a late night order, it should still be warmer.
August 15 · Conor KruseI ordered a chicken cachapa and told the girl more than 3 times no pink sauce or mayonnaise she wrote it in the paper I came out the restaurant to eat my food in my car I started eating but I felt it tasted weird to my surprise it had pink sauce which is made with mayonnaise I am allergic to it, I told them about it the girl there was like it doesn’t have any ,I told her look into the plate she realized it had the pink mayo sauce,I told them I want my money back they were saying we will make another one ,they said I was rude by me complaining about them not following the instructions the kitchen cook came out and was like you don’t have to complaint we can just make you another one I told him it’s a big deal when some one is allergic to something. One other thing I been here more than 10 times and never had this issue but today
March 05 · Emilio SantanaChicken taste terrible. Not worth no $60. 👎🏼
July 26 · EvelynVery small place. Food is delicious. Ordered 1 chimi de Pollo. 2 chicken cachapa. I patongo. 1 mofogitos. Gave her 100. It was 45 . She gave me back 50. Now it was less than delivery but really? What happened to me 5? I guess that was tip?
January 30 · Ann SerranoThis was one of the rare few places open at 3 in the morning and serving vegetarian options in Yonkers. I got myself patacón and I was not essentially pleased with it but hey I got something at such an odd time so I’m not complaining. #fattiesgottaeat lol
February 17 · Anukriti Verma
More Best Restaurants Near Me
La Guadalupana Pizzeria4.0 (80 reviews)262A Riverdale Ave, Yonkers, NY 10705, USA
Picante4.0 (140 reviews)299 S Broadway, Yonkers, NY 10705, USA
Atlixcayotl Taqueria3.0 (153 reviews)297 S Broadway, Yonkers, NY 10705, USA
Lulo S Broadway Restaurant3.0 (14 reviews)295 S Broadway, Yonkers, NY 10705, USA
La Pupusa Loca4.0 (851 reviews)285 S Broadway, Yonkers, NY 10705, USA
Drcafe restaurant0.0 (0 reviews)275 S Broadway, Yonkers, NY 10705, USA
Apollon Restaurant4.0 (64 reviews)347B S Broadway, Yonkers, NY 10705, USA
Silvio's Italian Restaurant & Pizzeria4.0 (525 reviews)351 S Broadway, Yonkers, NY 10705, USA
Grill House of Yonkers4.0 (730 reviews)326 S Broadway, Yonkers, NY 10705, USA
Margarita's Restaurant & Lounge4.0 (216 reviews)332 S Broadway, Yonkers, NY 10705, USA
Papa Johns Pizza3.0 (298 reviews)314 S Broadway, Yonkers, NY 10705, USA
White Castle4.0 (1846 reviews)257 S Broadway, Yonkers, NY 10705, USA
Categories
Top Visited Sites
Tipico Express2.0 (27 reviews)
McDonald's3.0 (1678 reviews)
Checkers3.0 (261 reviews)
Bubba Gump Shrimp Co.4.0 (14945 reviews)
Poke Rice4.0 (412 reviews)
BX Lobster4.0 (88 reviews)Trending Bites & Banter Posts
Your Ultimate Guide to Hidden Gem Restaurants | Brunch & Snack Chat
Your Ultimate Guide to Memorable Dining Experiences
From Street Eats to Fine Dining: Food Trends in the U.S.
Best Restaurants: Tips, Trends, and Secrets to Enhance Your Dining Experience
Why Locals Swear by Food Festivals: The Best Culinary Experiences
12 Seafood Places That Will Surprise You: Hidden Gems and Local Favorites
