Brunch & Snack Chat
Brunch & Snack ChatBites & BanterBest Restaurants Near Me
Ohio

Brunch & Snack ChatBest Restaurants Near MeNew YorkBronx CountyMorris ParkBest Restaurants in Morris Park AvenueHealthy Fresh
Healthy Fresh ico

Healthy Fresh
- 1033 Morris Park Ave, Bronx, NY 10461

Health food restaurant, Juice shop ★4.0 (50)·$10–20

1033 Morris Park Ave, Bronx, NY 10461, USA

4.0
Ordered here for the first time because I was craving a chicken caesar salad wrap. But I was VERY disappointed not only in the flavors of the food, but in the quantity for the price.This wrap was $13+ because I added French fries (which were $1.50). You can eat the wrap in 3 bites! The chicken was super dry and lacked flavor, the wrap barely had any dressing and tasted burnt. Absolutely terrible experience.. In the picture you will see half the wrap, and it’s smaller than the ginger ale. Barely had any filling. Do not order from here unless you want really small portions of mediocre food.Plenty of deli’s in the area that make better food, bigger portions & great pricing. This is what I get for being lazy and not heading to a worthy location.The healthy fresh owners should be ashamed of the mediocrity. - Vianny Gutierrez
Healthy Fresh Overview Intro Menu Detail Photos Location Reviews
$10–20 per person Reported by 50 people$1–10$10–20$20–30

Healthy Fresh Introduce

Welcome to Healthy Fresh, a beloved juice shop and healthy food restaurant nestled in the heart of the Bronx, New York. If you're on the hunt for a delicious and nutritious way to fuel your day, look no further. Healthy Fresh stands out as a local gem, offering a diverse menu that caters to every craving, from invigorating fresh juices and protein-packed smoothies to hearty wraps, salads, and more. Our mission is to make healthy eating accessible, convenient, and most importantly, delicious for the busy New Yorker.

Our commitment to using fresh, quality ingredients is at the core of everything we do. We believe that what you put into your body matters, and our menu is thoughtfully crafted to support a healthy lifestyle without compromising on flavor. Whether you're a college student looking for a quick and nutritious meal between classes, a professional on your lunch break, or simply someone who appreciates good, wholesome food, Healthy Fresh has something for everyone. Our casual and cozy atmosphere makes it the perfect spot to relax and recharge, or you can grab your order to go and get back to your busy day.

We're not just a juice shop; we're a community hub where health-conscious individuals can find their favorite meals and discover new ones. The diverse range of options, including vegan and vegetarian choices, ensures that everyone feels welcome. Healthy Fresh is more than a place to eat—it's a destination for wellness in the Bronx.


Location and Accessibility

You can find Healthy Fresh conveniently located at 1033 Morris Park Ave, Bronx, NY 10461. Our prime location in the Morris Park neighborhood makes us easily accessible for residents and visitors alike. We are situated in a vibrant area, close to public transport and other local amenities, making it a simple stop whether you're commuting or just running errands.

For those who drive, please be aware that parking is available on the street, but it is paid street parking. We recommend planning your visit accordingly. Our establishment is also designed to be accessible to everyone, featuring a wheelchair-accessible entrance to ensure a comfortable experience for all our customers. Whether you choose to dine in, take out, or have your meal delivered, Healthy Fresh is a convenient choice for any occasion.


Services Offered

At Healthy Fresh, we pride ourselves on offering a wide variety of services to meet the needs of our diverse clientele. Our goal is to provide a seamless and satisfying experience, whether you're visiting us in person or enjoying our food from the comfort of your home.

  • Dine-in: Enjoy our casual, cozy, and trendy atmosphere. Our space is perfect for a solo meal or a quick bite with friends. The ambiance is relaxed and welcoming, providing a quiet escape from the city's hustle and bustle.

  • Takeout: In a rush? Call ahead or stop by to place your order for a quick pickup. Our efficient team will have your meal ready to go, so you can enjoy your healthy food on the move.

  • Delivery: Can't make it to the shop? No problem. We offer convenient delivery services so you can get your favorite juices, smoothies, and meals delivered right to your doorstep. This is a perfect option for a lazy day or a busy workday.

  • Catering: While we are a great spot for individual meals, we also provide options for larger groups and events. Our menu is versatile and can be customized to suit your needs, whether it's a corporate lunch or a small gathering. We're happy to discuss your specific requirements to ensure your event is a success.

  • Meal Planning: For our regular customers, we can help with meal planning. Talk to our staff about how we can provide you with consistent, healthy meals throughout the week. This service is ideal for those who want to maintain a healthy diet but don't have the time to cook every day.


Features and Highlights

What makes Healthy Fresh a standout choice for healthy dining in the Bronx? We have several features that set us apart from the competition. Our menu is designed with health and flavor in mind, offering something for everyone.

  • Great Tea Selection: We are proud to offer a great selection of teas, perfect for a soothing hot drink or a refreshing iced beverage. Our tea menu is carefully curated to include a variety of flavors and health benefits, making it a great alternative to coffee or sugary drinks.

  • Healthy and Dietary Options: Our menu is packed with healthy options, including quick bites, small plates, and full meals. We offer a robust selection of vegan and vegetarian choices, ensuring that everyone can find a delicious meal that fits their dietary preferences.

  • Wide Range of Offerings: From fresh juices and smoothies to salads, wraps, and paninis, our menu is incredibly diverse. Whether you're in the mood for a light snack or a full meal, you'll find plenty of delicious choices to satisfy your hunger.

  • Popular for Any Time of Day: Healthy Fresh is popular for breakfast, lunch, and dinner. Our extensive menu and convenient hours make us a great choice for any meal. Start your day with one of our breakfast wraps or hot oatmeals, grab a salad for a light lunch, or enjoy a panini or burger for dinner.

  • Student-Friendly Crowd: Our location and affordable menu make us a popular spot for college students. The casual and trendy atmosphere is perfect for studying or catching up with friends. We offer a welcoming environment where you can feel at home while enjoying a healthy meal.


Contact Information

For more information or to place an order, feel free to contact us.

  • Address: 1033 Morris Park Ave, Bronx, NY 10461, USA

  • Phone: (718) 684-6411


What Is Worth Choosing

Choosing Healthy Fresh means choosing quality, convenience, and a commitment to health. We are more than just a place to get a quick drink; we are a destination for nourishing your body and mind. Our menu is built around the idea that healthy food can also be flavorful and exciting.

Our juices and smoothies are made with fresh, vibrant ingredients. You can feel the difference with every sip. The "Energy Smoothies To Start Your Day" category, for example, features concoctions like the "Incredible" smoothie with banana, pineapple, spinach, apple, and cucumber, designed to give you a natural boost. Our "Protein Smoothies" are a favorite among athletes and fitness enthusiasts, packed with protein and wholesome ingredients like peanut butter, oats, and various fruits.

But we're not just about drinks. Our food menu is equally impressive. Our breakfast wraps, such as the "#1 Egg Whites, Turkey Sausage & Avocado" wrap, are perfect for a satisfying start to your day. For lunch or dinner, you can build your own salad with fresh ingredients or try one of our signature wraps, paninis, or quesadillas. Our "Go Green To Be Clean" juice section is a testament to our focus on detoxification and wellness, featuring juices like the "Green Juice" with spinach, kale, apple, cucumber, celery, and pineapple.

We understand that everyone has different tastes and dietary needs. That's why we offer a "Create Your Own" option for both smoothies and juices, allowing you to customize your drink exactly to your liking. Our friendly and professional staff are always ready to help you navigate the menu and find the perfect meal for your needs. We take pride in our service, aiming to provide a fast, friendly, and professional experience every time you visit.

While we are known for our healthy options, we also offer classic comfort foods like our "Cheese Burger Deluxe" and "French Fries." This variety ensures that everyone in your group can find something they love, making us a great choice for a diverse crowd.

Healthy Fresh is committed to being a positive force in the community, providing nutritious and delicious food that supports a healthy lifestyle. We invite you to come and experience the difference for yourself. Whether you are a regular or a first-time visitor, we are confident that you will leave feeling refreshed and satisfied.

Healthy Fresh Menu

  • BREAKFAST - Breakfast

  • Coffee
  • BREAKFAST COMBO $5.50
  • Yogurt Muffins $2.95
  • Tea
  • Pancakes
  • Iced Coffee
  • English Muffin Sandwich $4.50
  • Bagel With Cream Cheese (Plain Bagel Only) $3.50
  • Create Egg Sandwich
  • BREAKFAST - Breakfast Wraps

  • #1 Egg Whites, Turkey Sausage & Avocado $7.99
  • #2 Egg Whites, Turkey Bacon & Avocado $7.99
  • #3 Egg Whites, Bacon, Swiis & Avocado $7.99
  • #4 Egg Whites, Spinach, Broccoli & Avocado $7.99
  • #5 Egg Whites, Turkey Bacon, Cheddar Cheese & Salsa $7.99
  • #6 Egg Whites, Grilled Chicken, Monterrey Jack Cheese & Chipotle Mayo $7.99
  • BREAKFAST - Hot Oatmeals

  • #1 Strawberry, Banana, Granola & Cinnamon $5.49
  • #2 Walnuts, Pecans, Almonds & Agave $5.49
  • #3 Peanut Butter, Apples & Agave $5.49
  • #4 Dried Cranberries, Raisins, Apples & Agave $5.49
  • #5 Strawberry, Banana, Blueberry & Cinnamon $5.49
  • #6 Banana, Chia Seeds & Agave $5.49
  • Breakfast

  • Coffee
  • BREAKFAST COMBO $5.50
  • Yogurt Muffins $2.95
  • Tea
  • Pancakes
  • Iced Coffee
  • English Muffin Sandwich $4.50
  • Bagel With Cream Cheese (Plain Bagel Only) $3.50
  • Create Egg Sandwich
  • Breakfast Wraps

  • #1 Egg Whites, Turkey Sausage & Avocado $7.99
  • #2 Egg Whites, Turkey Bacon & Avocado $7.99
  • #3 Egg Whites, Bacon, Swiis & Avocado $7.99
  • #4 Egg Whites, Spinach, Broccoli & Avocado $7.99
  • #5 Egg Whites, Turkey Bacon, Cheddar Cheese & Salsa $7.99
  • #6 Egg Whites, Grilled Chicken, Monterrey Jack Cheese & Chipotle Mayo $7.99
  • Hot Oatmeals

  • #1 Strawberry, Banana, Granola & Cinnamon $5.49
  • #2 Walnuts, Pecans, Almonds & Agave $5.49
  • #3 Peanut Butter, Apples & Agave $5.49
  • #4 Dried Cranberries, Raisins, Apples & Agave $5.49
  • #5 Strawberry, Banana, Blueberry & Cinnamon $5.49
  • #6 Banana, Chia Seeds & Agave $5.49
  • ALL DAY - Healthy Fresh Combinations

  • A1- Mega Mix

    Strawberry, Pineapple & Papaya with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A2- Berry Happy

    Strawberry, Blueberry & Blackberry with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A3- Tropical Mix

    Mango, Banana & Pineapple with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A4- Mango Tropical

    Mango, Peach, Pineapple & Orange Juice

  • A5- The Secret

    Strawberry, Blueberry & Mango with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A6- Baby Bottle

    Strawberry, Banana & Blueberry with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A7- Mango Tango

    Mango & Orange Juice

  • A8- Piña Colada

    Pineapple & Coco Lopez

  • ALL DAY - Energy Smoothies To Start Your Day

  • B1- Incredible- Banana, Pineapple, Spinach, Apple & Cucumber
  • B2- Mango, Strawberry, Raisins, Oatmeal, Agave & Almond Milk
  • B3- Banana, Mango, Agave & Almond Milk
  • B4- Strawberry, Pineapple, Mango, Agave & Almond Milk
  • B5- Strawberry, Blueberry, Blackberry, Agave & Almond Milk
  • B6- Papaya, Apple, Spinach, Agave & Orange Juice
  • Morning Blast- Plum, Mango, Banana, Spinach, Ginger & Orange Juice
  • Best DATE Ever! - Banana, Dates, Pecans, Almond Milk & Cinnamon
  • ALL DAY - Build Your Immune System

  • C1- Beet, Carrot & Orange
  • C2- Pineapple, Apple & Ginger
  • C3- Grapefruit, Orange, Pineapple & Ginger
  • C4- Beet, Carrot, Apple, Celery & Ginger
  • C5- Spinach, Beet, Carrot & Apple
  • Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
  • ALL DAY - Go Green To Be Clean

  • D1- Aloe Vera, Pineapple, Apple & Cucumber
  • Green Juice -D2- Spinach, Kale, Apple, Cucumber, Celery & Pineapple
  • D3- Green Apple, Kale, Pineapple, Cucumber & Lemon
  • D4- Aloe Vera, Pineapple, Apple, Cucumber, Orange & Lime
  • D5- Cucumber, Celery, Apple & Lime
  • D6- Cucumber, Apple, Pineapple & Lime
  • ALL DAY - Protein Smoothies

  • E1- Banana, Peanut Butter & Chocolate Protein

    Made with Almond Milk (No sugar Added)

  • E2- Pineapple, Banana, Spinach, Oatmeal & Protein

    Made with Almond Milk (No sugar Added)

  • E3- Strawberry, Blueberry, Almonds, Oatmeal & Protein

    Made with Almond Milk (No sugar Added)

  • E4- Banana, Blueberry, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E5- Papaya, Banana, Pecans, Almonds & Protein

    Made with Almond Milk (No sugar Added)

  • E6- Banana, Cantaloupe, Pecans, Walnuts & Protein

    Made with Almond Milk (No sugar Added)

  • E7- Blueberry, Banana, Oatmeal, Pecans & Protein

    Made with Almond Milk (No sugar Added)

  • E8- Mango, Banana, Peach, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E9- Mango, Apples, Kale, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E10- Beets, Blueberry, Kale, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • ALL DAY - Refreshers

  • Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
  • Orange Juice
  • Lemonade
  • Slushy Lemonade
  • Watermelon Lemonade

    Watermelon with Lime and a hint of Agave.

  • Picante Watermelon

    Watermelon, Tajin Powder & Agave *lightly spicy*

  • Cucumber Refresher

    Cucumber, Lime & Agave.

  • ALL DAY - Create Smoothie/ Juice🍋🍓

  • 🍌Create Smoothie 🍓
  • Create Juice 🍏
  • ALL DAY - Salads

  • Chicken Greek Salad $12.95

    Romaine Lettuce, Grilled Chicken, Black Olives, Tomatoes, Cucumbers, Red Onions, Peppers & Feta Cheese with Oil and Vinegar

  • Chicken Caesar Salad $8.95

    Romaine Lettuce, Grilled Chicken, Parmesan Cheese, Croutons & Ceasar Dressing

  • Create Salad $3.50
  • Fruit Salad
  • ALL DAY - Wraps

  • California Wrap

    Grilled Chicken, Fresh Mozzarella, Avocado, Lettuce, Tomato & Ranch Dressing

  • Arizona Wrap

    Chicken Cutlet, Monterrey Cheese, Jalapeños Peppers, Lettuce, Tomato & Mayo

  • Monterrey Wrap

    Chicken Cutlet, Monterrey Cheese, Turkey Bacon, Lettuce & Chipotle Sauce

  • Caesar Wrap

    Grilled Chicken, Parmesan Cheese, Crispy Lettuce, Croutons & Caesar Dressing

  • Roma Wrap

    Grilled Chicken, Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce

  • Italian Wrap

    Grilled Chicken, Cucumbers, Crispy Lettuce & Italian Dressing

  • ALL DAY - Paninis

  • Pesto Panini

    Grilled Chicken, Fresh Mozzarella, Roasted Peppers & Pesto Sauce

  • Parmesan Panini

    Chicken Cutlet, Fresh Mozzarella, Parmesan Cheese & Marinara Sauce

  • Fajita Panini

    Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa

  • Tuna Melt

    Tuna Salad, Mayo, Cheddar Cheese, Lettuce & Tomato

  • Tuscan Panini

    Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce

  • Chicken Club

    Grilled Chicken, Bacon, Lettuce, Tomato & Mayo

  • Teriyaki Panini

    Grilled Chicken, Zucchini, Squash, Carrots, Mozzarella Cheese & Teriyaki Sauce

  • ALL DAY - Quesadillas

  • Chicken Quesadilla

    Grilled Chicken & Mozzarella

  • Fajita Quesadilla

    Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa

  • Vegetable Quesadilla

    Fresh Mozzarella, Grilled Zucchini, Squash & Carrots

  • ALL DAY - Vegan Wraps

  • Kaiser Wrap

    Grilled Zucchini, Grilled Squash, Broccoli Rabe, Avocado & Chipotle Sauce on a Whole Wheat Wrap

  • Summer Time Wrap

    Veggie Patty, Cucumbers, Avocado, Roasted Peppers & Hummus on a Whole Wheat Wrap

  • April Wrap

    Chickpeas, Celery, Red Onions, Dried Cranberries, Vegan Mayo & Iceberg Lettuce on a Whole Wheat Wrap

  • ALL DAY - Burgers/ Heroes

  • #1 Cheese Burger Deluxe $10.95

    American cheese with Lettuce, tomato & French Fries

  • #2 Bacon Cheese Burger Deluxe $12.95
  • #3 Burger With Swiss, Grilled Onions, Grilled Mushroom & BBQ Sauce $12.95

    Burger with Swiss, Grilled Onions, Grilled Mushrooms & BBQ Sauce

  • #4 Burger With Muenster Cheese & Avocado $12.95

    Burger with Muenster Cheese & Avocado

  • Grilled Chicken Hero

    Grilled Chicken, Muenster cheese, Avocado, Lettuce, Tomatoes and Ranch Dressing.

  • Cajun Chicken Hero

    Grilled Chicken, Onions, Peppers, Pepper Jack Cheese, Avocado, Lettuce, Tomatoes, chipotle mayo.

  • Big Hero

    Grilled chicken, Bacon, Muenster Cheese, Lettuce, tomato, Chipotle Mayo.

  • ALL DAY - Energy Shots

  • Ginger Lemon Shot

    Ginger & Lemon

  • Power Shot

    Ginger, Lemon, Cayenne Pepper & Turmeric

  • Booster Shot

    Beets, Garlic, Turmeric, Ginger & Lemon

  • Vitamin C Shot

    Grapefruit, Apple, Pineapple, Orange, Turmeric, Ginger & Lemon

  • ALL DAY - Sides/ Soups

  • French Fries $4.00
  • Chicken Empanada $3.00
  • Cheese Empanada $3.00
  • Sauce (1oz) $0.00
  • Chicken & Vegetables Soup
  • Lentil Soup
  • Yogurt Muffins $2.95
  • ALL DAY - Drinks

  • Can Soda $1.50
  • Ice Cup
  • Water Bottle $1.50
  • Iced Coffee
  • Healthy Fresh Combinations

  • A1- Mega Mix

    Strawberry, Pineapple & Papaya with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A2- Berry Happy

    Strawberry, Blueberry & Blackberry with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A3- Tropical Mix

    Mango, Banana & Pineapple with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A4- Mango Tropical

    Mango, Peach, Pineapple & Orange Juice

  • A5- The Secret

    Strawberry, Blueberry & Mango with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A6- Baby Bottle

    Strawberry, Banana & Blueberry with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A7- Mango Tango

    Mango & Orange Juice

  • A8- Piña Colada

    Pineapple & Coco Lopez

  • Energy Smoothies To Start Your Day

  • B1- Incredible- Banana, Pineapple, Spinach, Apple & Cucumber
  • B2- Mango, Strawberry, Raisins, Oatmeal, Agave & Almond Milk
  • B3- Banana, Mango, Agave & Almond Milk
  • B4- Strawberry, Pineapple, Mango, Agave & Almond Milk
  • B5- Strawberry, Blueberry, Blackberry, Agave & Almond Milk
  • B6- Papaya, Apple, Spinach, Agave & Orange Juice
  • Morning Blast- Plum, Mango, Banana, Spinach, Ginger & Orange Juice
  • Best DATE Ever! - Banana, Dates, Pecans, Almond Milk & Cinnamon
  • Build Your Immune System

  • C1- Beet, Carrot & Orange
  • C2- Pineapple, Apple & Ginger
  • C3- Grapefruit, Orange, Pineapple & Ginger
  • C4- Beet, Carrot, Apple, Celery & Ginger
  • C5- Spinach, Beet, Carrot & Apple
  • Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
  • Go Green To Be Clean

  • D1- Aloe Vera, Pineapple, Apple & Cucumber
  • Green Juice -D2- Spinach, Kale, Apple, Cucumber, Celery & Pineapple
  • D3- Green Apple, Kale, Pineapple, Cucumber & Lemon
  • D4- Aloe Vera, Pineapple, Apple, Cucumber, Orange & Lime
  • D5- Cucumber, Celery, Apple & Lime
  • D6- Cucumber, Apple, Pineapple & Lime
  • Protein Smoothies

  • E1- Banana, Peanut Butter & Chocolate Protein

    Made with Almond Milk (No sugar Added)

  • E2- Pineapple, Banana, Spinach, Oatmeal & Protein

    Made with Almond Milk (No sugar Added)

  • E3- Strawberry, Blueberry, Almonds, Oatmeal & Protein

    Made with Almond Milk (No sugar Added)

  • E4- Banana, Blueberry, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E5- Papaya, Banana, Pecans, Almonds & Protein

    Made with Almond Milk (No sugar Added)

  • E6- Banana, Cantaloupe, Pecans, Walnuts & Protein

    Made with Almond Milk (No sugar Added)

  • E7- Blueberry, Banana, Oatmeal, Pecans & Protein

    Made with Almond Milk (No sugar Added)

  • E8- Mango, Banana, Peach, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E9- Mango, Apples, Kale, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E10- Beets, Blueberry, Kale, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • Refreshers

  • Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
  • Orange Juice
  • Lemonade
  • Slushy Lemonade
  • Watermelon Lemonade

    Watermelon with Lime and a hint of Agave.

  • Picante Watermelon

    Watermelon, Tajin Powder & Agave *lightly spicy*

  • Cucumber Refresher

    Cucumber, Lime & Agave.

  • Create Smoothie/ Juice🍋🍓

  • 🍌Create Smoothie 🍓
  • Create Juice 🍏
  • Salads

  • Chicken Greek Salad $12.95

    Romaine Lettuce, Grilled Chicken, Black Olives, Tomatoes, Cucumbers, Red Onions, Peppers & Feta Cheese with Oil and Vinegar

  • Chicken Caesar Salad $8.95

    Romaine Lettuce, Grilled Chicken, Parmesan Cheese, Croutons & Ceasar Dressing

  • Create Salad $3.50
  • Fruit Salad
  • Wraps

  • California Wrap

    Grilled Chicken, Fresh Mozzarella, Avocado, Lettuce, Tomato & Ranch Dressing

  • Arizona Wrap

    Chicken Cutlet, Monterrey Cheese, Jalapeños Peppers, Lettuce, Tomato & Mayo

  • Monterrey Wrap

    Chicken Cutlet, Monterrey Cheese, Turkey Bacon, Lettuce & Chipotle Sauce

  • Caesar Wrap

    Grilled Chicken, Parmesan Cheese, Crispy Lettuce, Croutons & Caesar Dressing

  • Roma Wrap

    Grilled Chicken, Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce

  • Italian Wrap

    Grilled Chicken, Cucumbers, Crispy Lettuce & Italian Dressing

  • Paninis

  • Pesto Panini

    Grilled Chicken, Fresh Mozzarella, Roasted Peppers & Pesto Sauce

  • Parmesan Panini

    Chicken Cutlet, Fresh Mozzarella, Parmesan Cheese & Marinara Sauce

  • Fajita Panini

    Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa

  • Tuna Melt

    Tuna Salad, Mayo, Cheddar Cheese, Lettuce & Tomato

  • Tuscan Panini

    Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce

  • Chicken Club

    Grilled Chicken, Bacon, Lettuce, Tomato & Mayo

  • Teriyaki Panini

    Grilled Chicken, Zucchini, Squash, Carrots, Mozzarella Cheese & Teriyaki Sauce

  • Quesadillas

  • Chicken Quesadilla

    Grilled Chicken & Mozzarella

  • Fajita Quesadilla

    Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa

  • Vegetable Quesadilla

    Fresh Mozzarella, Grilled Zucchini, Squash & Carrots

  • Vegan Wraps

  • Kaiser Wrap

    Grilled Zucchini, Grilled Squash, Broccoli Rabe, Avocado & Chipotle Sauce on a Whole Wheat Wrap

  • Summer Time Wrap

    Veggie Patty, Cucumbers, Avocado, Roasted Peppers & Hummus on a Whole Wheat Wrap

  • April Wrap

    Chickpeas, Celery, Red Onions, Dried Cranberries, Vegan Mayo & Iceberg Lettuce on a Whole Wheat Wrap

  • Burgers/ Heroes

  • #1 Cheese Burger Deluxe $10.95

    American cheese with Lettuce, tomato & French Fries

  • #2 Bacon Cheese Burger Deluxe $12.95
  • #3 Burger With Swiss, Grilled Onions, Grilled Mushroom & BBQ Sauce $12.95

    Burger with Swiss, Grilled Onions, Grilled Mushrooms & BBQ Sauce

  • #4 Burger With Muenster Cheese & Avocado $12.95

    Burger with Muenster Cheese & Avocado

  • Grilled Chicken Hero

    Grilled Chicken, Muenster cheese, Avocado, Lettuce, Tomatoes and Ranch Dressing.

  • Cajun Chicken Hero

    Grilled Chicken, Onions, Peppers, Pepper Jack Cheese, Avocado, Lettuce, Tomatoes, chipotle mayo.

  • Big Hero

    Grilled chicken, Bacon, Muenster Cheese, Lettuce, tomato, Chipotle Mayo.

  • Energy Shots

  • Ginger Lemon Shot

    Ginger & Lemon

  • Power Shot

    Ginger, Lemon, Cayenne Pepper & Turmeric

  • Booster Shot

    Beets, Garlic, Turmeric, Ginger & Lemon

  • Vitamin C Shot

    Grapefruit, Apple, Pineapple, Orange, Turmeric, Ginger & Lemon

  • Sides/ Soups

  • French Fries $4.00
  • Chicken Empanada $3.00
  • Cheese Empanada $3.00
  • Sauce (1oz) $0.00
  • Chicken & Vegetables Soup
  • Lentil Soup
  • Yogurt Muffins $2.95
  • Drinks

  • Can Soda $1.50
  • Ice Cup
  • Water Bottle $1.50
  • Iced Coffee

Healthy Fresh Details

  • Service options

  • Delivery
  • Takeout
  • Dine-in
  • Highlights

  • Great tea selection
  • Popular for

  • Breakfast
  • Lunch
  • Dinner
  • Solo dining
  • Accessibility

  • Wheelchair accessible entrance
  • Offerings

  • Coffee
  • Healthy options
  • Quick bite
  • Small plates
  • Vegan options
  • Vegetarian options
  • Dining options

  • Breakfast
  • Brunch
  • Lunch
  • Dinner
  • Dessert
  • Table service
  • Atmosphere

  • Casual
  • Cozy
  • Quiet
  • Trendy
  • Crowd

  • College students
  • Planning

  • Accepts reservations
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Credit cards
  • Children

  • Good for kids
  • Parking

  • Paid street parking

Healthy Fresh Photos

Healthy Fresh Picture 1Healthy Fresh Picture 2Healthy Fresh Picture 3Healthy Fresh Picture 4Healthy Fresh Picture 5Healthy Fresh Picture 6Healthy Fresh Picture 7Healthy Fresh Picture 8Healthy Fresh Picture 9Healthy Fresh Picture 10

Healthy Fresh Location

Healthy Fresh

1033 Morris Park Ave, Bronx, NY 10461, USA

Healthy Fresh Reviews

An average rating of ★4.4 from 332 user reviews.

priceswrappanininameempanadasdeliveryfriespeanut butterto gocheese empanada

★ 5★ 4★ 3★ 2★ 1

More Best Restaurants Near Me

  • Osaka sushiOsaka sushi4.0 (84 reviews)

    1041 Morris Park Ave, Bronx, NY 10461, USA

  • Nana's KitchenNana's Kitchen4.0 (209 reviews)

    1809 Hone Ave, Bronx, NY 10461, USA

  • Morris Park InnMorris Park Inn4.0 (189 reviews)

    1024 Morris Park Ave, Bronx, NY 10461, USA

  • Emilio's of Morris ParkEmilio's of Morris Park4.0 (1274 reviews)

    1051 Morris Park Ave, Bronx, NY 10461, USA

  • Addeou2019s of the BronxAddeou2019s of the Bronx4.0 (548 reviews)

    1056 Morris Park Ave, Bronx, NY 10461, USA

  • Lucianou2019s PizzaLucianou2019s Pizza4.0 (262 reviews)

    1005 Morris Park Ave # A, Bronx, NY 10462, USA

  • Aguilaru2019s Mexican GroceryAguilaru2019s Mexican Grocery4.0 (194 reviews)

    1060 Morris Park Ave, Bronx, NY 10461, USA

  • La Masa RestaurantLa Masa Restaurant4.0 (1360 reviews)

    1000 Morris Park Ave, Bronx, NY 10462, USA

  • Prizreni GrillPrizreni Grill4.0 (45 reviews)

    1080 Morris Park Ave, Bronx, NY 10461, USA

  • Patsy's Pizzeria Morris ParkPatsy's Pizzeria Morris Park4.0 (499 reviews)

    980 Morris Park Ave, Bronx, NY 10462, USA

  • Golden Eagle RestaurantGolden Eagle Restaurant4.0 (466 reviews)

    975 Morris Park Ave, Bronx, NY 10462, USA

  • Patricia's of Morris ParkPatricia's of Morris Park4.0 (350 reviews)

    1082 Morris Park Ave, Bronx, NY 10461, USA

  • Categories

    Top Visited Sites

    Trending Bites & Banter Posts