Healthy Fresh Introduce
Welcome to Healthy Fresh, a beloved juice shop and healthy food restaurant nestled in the heart of the Bronx, New York. If you're on the hunt for a delicious and nutritious way to fuel your day, look no further. Healthy Fresh stands out as a local gem, offering a diverse menu that caters to every craving, from invigorating fresh juices and protein-packed smoothies to hearty wraps, salads, and more. Our mission is to make healthy eating accessible, convenient, and most importantly, delicious for the busy New Yorker.
Our commitment to using fresh, quality ingredients is at the core of everything we do. We believe that what you put into your body matters, and our menu is thoughtfully crafted to support a healthy lifestyle without compromising on flavor. Whether you're a college student looking for a quick and nutritious meal between classes, a professional on your lunch break, or simply someone who appreciates good, wholesome food, Healthy Fresh has something for everyone. Our casual and cozy atmosphere makes it the perfect spot to relax and recharge, or you can grab your order to go and get back to your busy day.
We're not just a juice shop; we're a community hub where health-conscious individuals can find their favorite meals and discover new ones. The diverse range of options, including vegan and vegetarian choices, ensures that everyone feels welcome. Healthy Fresh is more than a place to eat—it's a destination for wellness in the Bronx.
You can find Healthy Fresh conveniently located at 1033 Morris Park Ave, Bronx, NY 10461. Our prime location in the Morris Park neighborhood makes us easily accessible for residents and visitors alike. We are situated in a vibrant area, close to public transport and other local amenities, making it a simple stop whether you're commuting or just running errands.
For those who drive, please be aware that parking is available on the street, but it is paid street parking. We recommend planning your visit accordingly. Our establishment is also designed to be accessible to everyone, featuring a wheelchair-accessible entrance to ensure a comfortable experience for all our customers. Whether you choose to dine in, take out, or have your meal delivered, Healthy Fresh is a convenient choice for any occasion.
At Healthy Fresh, we pride ourselves on offering a wide variety of services to meet the needs of our diverse clientele. Our goal is to provide a seamless and satisfying experience, whether you're visiting us in person or enjoying our food from the comfort of your home.
Dine-in: Enjoy our casual, cozy, and trendy atmosphere. Our space is perfect for a solo meal or a quick bite with friends. The ambiance is relaxed and welcoming, providing a quiet escape from the city's hustle and bustle.
Takeout: In a rush? Call ahead or stop by to place your order for a quick pickup. Our efficient team will have your meal ready to go, so you can enjoy your healthy food on the move.
Delivery: Can't make it to the shop? No problem. We offer convenient delivery services so you can get your favorite juices, smoothies, and meals delivered right to your doorstep. This is a perfect option for a lazy day or a busy workday.
Catering: While we are a great spot for individual meals, we also provide options for larger groups and events. Our menu is versatile and can be customized to suit your needs, whether it's a corporate lunch or a small gathering. We're happy to discuss your specific requirements to ensure your event is a success.
Meal Planning: For our regular customers, we can help with meal planning. Talk to our staff about how we can provide you with consistent, healthy meals throughout the week. This service is ideal for those who want to maintain a healthy diet but don't have the time to cook every day.
What makes Healthy Fresh a standout choice for healthy dining in the Bronx? We have several features that set us apart from the competition. Our menu is designed with health and flavor in mind, offering something for everyone.
Great Tea Selection: We are proud to offer a great selection of teas, perfect for a soothing hot drink or a refreshing iced beverage. Our tea menu is carefully curated to include a variety of flavors and health benefits, making it a great alternative to coffee or sugary drinks.
Healthy and Dietary Options: Our menu is packed with healthy options, including quick bites, small plates, and full meals. We offer a robust selection of vegan and vegetarian choices, ensuring that everyone can find a delicious meal that fits their dietary preferences.
Wide Range of Offerings: From fresh juices and smoothies to salads, wraps, and paninis, our menu is incredibly diverse. Whether you're in the mood for a light snack or a full meal, you'll find plenty of delicious choices to satisfy your hunger.
Popular for Any Time of Day: Healthy Fresh is popular for breakfast, lunch, and dinner. Our extensive menu and convenient hours make us a great choice for any meal. Start your day with one of our breakfast wraps or hot oatmeals, grab a salad for a light lunch, or enjoy a panini or burger for dinner.
Student-Friendly Crowd: Our location and affordable menu make us a popular spot for college students. The casual and trendy atmosphere is perfect for studying or catching up with friends. We offer a welcoming environment where you can feel at home while enjoying a healthy meal.
For more information or to place an order, feel free to contact us.
Address: 1033 Morris Park Ave, Bronx, NY 10461, USA
Phone: (718) 684-6411
Choosing Healthy Fresh means choosing quality, convenience, and a commitment to health. We are more than just a place to get a quick drink; we are a destination for nourishing your body and mind. Our menu is built around the idea that healthy food can also be flavorful and exciting.
Our juices and smoothies are made with fresh, vibrant ingredients. You can feel the difference with every sip. The "Energy Smoothies To Start Your Day" category, for example, features concoctions like the "Incredible" smoothie with banana, pineapple, spinach, apple, and cucumber, designed to give you a natural boost. Our "Protein Smoothies" are a favorite among athletes and fitness enthusiasts, packed with protein and wholesome ingredients like peanut butter, oats, and various fruits.
But we're not just about drinks. Our food menu is equally impressive. Our breakfast wraps, such as the "#1 Egg Whites, Turkey Sausage & Avocado" wrap, are perfect for a satisfying start to your day. For lunch or dinner, you can build your own salad with fresh ingredients or try one of our signature wraps, paninis, or quesadillas. Our "Go Green To Be Clean" juice section is a testament to our focus on detoxification and wellness, featuring juices like the "Green Juice" with spinach, kale, apple, cucumber, celery, and pineapple.
We understand that everyone has different tastes and dietary needs. That's why we offer a "Create Your Own" option for both smoothies and juices, allowing you to customize your drink exactly to your liking. Our friendly and professional staff are always ready to help you navigate the menu and find the perfect meal for your needs. We take pride in our service, aiming to provide a fast, friendly, and professional experience every time you visit.
While we are known for our healthy options, we also offer classic comfort foods like our "Cheese Burger Deluxe" and "French Fries." This variety ensures that everyone in your group can find something they love, making us a great choice for a diverse crowd.
Healthy Fresh is committed to being a positive force in the community, providing nutritious and delicious food that supports a healthy lifestyle. We invite you to come and experience the difference for yourself. Whether you are a regular or a first-time visitor, we are confident that you will leave feeling refreshed and satisfied.
Healthy Fresh Menu
BREAKFAST - Breakfast
- Coffee
- BREAKFAST COMBO $5.50
- Yogurt Muffins $2.95
- Tea
- Pancakes
- Iced Coffee
- English Muffin Sandwich $4.50
- Bagel With Cream Cheese (Plain Bagel Only) $3.50
- Create Egg Sandwich
BREAKFAST - Breakfast Wraps
- #1 Egg Whites, Turkey Sausage & Avocado $7.99
- #2 Egg Whites, Turkey Bacon & Avocado $7.99
- #3 Egg Whites, Bacon, Swiis & Avocado $7.99
- #4 Egg Whites, Spinach, Broccoli & Avocado $7.99
- #5 Egg Whites, Turkey Bacon, Cheddar Cheese & Salsa $7.99
- #6 Egg Whites, Grilled Chicken, Monterrey Jack Cheese & Chipotle Mayo $7.99
BREAKFAST - Hot Oatmeals
- #1 Strawberry, Banana, Granola & Cinnamon $5.49
- #2 Walnuts, Pecans, Almonds & Agave $5.49
- #3 Peanut Butter, Apples & Agave $5.49
- #4 Dried Cranberries, Raisins, Apples & Agave $5.49
- #5 Strawberry, Banana, Blueberry & Cinnamon $5.49
- #6 Banana, Chia Seeds & Agave $5.49
Breakfast
- Coffee
- BREAKFAST COMBO $5.50
- Yogurt Muffins $2.95
- Tea
- Pancakes
- Iced Coffee
- English Muffin Sandwich $4.50
- Bagel With Cream Cheese (Plain Bagel Only) $3.50
- Create Egg Sandwich
Breakfast Wraps
- #1 Egg Whites, Turkey Sausage & Avocado $7.99
- #2 Egg Whites, Turkey Bacon & Avocado $7.99
- #3 Egg Whites, Bacon, Swiis & Avocado $7.99
- #4 Egg Whites, Spinach, Broccoli & Avocado $7.99
- #5 Egg Whites, Turkey Bacon, Cheddar Cheese & Salsa $7.99
- #6 Egg Whites, Grilled Chicken, Monterrey Jack Cheese & Chipotle Mayo $7.99
Hot Oatmeals
- #1 Strawberry, Banana, Granola & Cinnamon $5.49
- #2 Walnuts, Pecans, Almonds & Agave $5.49
- #3 Peanut Butter, Apples & Agave $5.49
- #4 Dried Cranberries, Raisins, Apples & Agave $5.49
- #5 Strawberry, Banana, Blueberry & Cinnamon $5.49
- #6 Banana, Chia Seeds & Agave $5.49
ALL DAY - Healthy Fresh Combinations
- A1- Mega Mix
Strawberry, Pineapple & Papaya with Evaporated Milk, Sugar Cinnamon & Vanilla
- A2- Berry Happy
Strawberry, Blueberry & Blackberry with Evaporated Milk, Sugar Cinnamon & Vanilla
- A3- Tropical Mix
Mango, Banana & Pineapple with Evaporated Milk, Sugar Cinnamon & Vanilla
- A4- Mango Tropical
Mango, Peach, Pineapple & Orange Juice
- A5- The Secret
Strawberry, Blueberry & Mango with Evaporated Milk, Sugar Cinnamon & Vanilla
- A6- Baby Bottle
Strawberry, Banana & Blueberry with Evaporated Milk, Sugar Cinnamon & Vanilla
- A7- Mango Tango
Mango & Orange Juice
- A8- Piña Colada
Pineapple & Coco Lopez
ALL DAY - Energy Smoothies To Start Your Day
- B1- Incredible- Banana, Pineapple, Spinach, Apple & Cucumber
- B2- Mango, Strawberry, Raisins, Oatmeal, Agave & Almond Milk
- B3- Banana, Mango, Agave & Almond Milk
- B4- Strawberry, Pineapple, Mango, Agave & Almond Milk
- B5- Strawberry, Blueberry, Blackberry, Agave & Almond Milk
- B6- Papaya, Apple, Spinach, Agave & Orange Juice
- Morning Blast- Plum, Mango, Banana, Spinach, Ginger & Orange Juice
- Best DATE Ever! - Banana, Dates, Pecans, Almond Milk & Cinnamon
ALL DAY - Build Your Immune System
- C1- Beet, Carrot & Orange
- C2- Pineapple, Apple & Ginger
- C3- Grapefruit, Orange, Pineapple & Ginger
- C4- Beet, Carrot, Apple, Celery & Ginger
- C5- Spinach, Beet, Carrot & Apple
- Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
ALL DAY - Go Green To Be Clean
- D1- Aloe Vera, Pineapple, Apple & Cucumber
- Green Juice -D2- Spinach, Kale, Apple, Cucumber, Celery & Pineapple
- D3- Green Apple, Kale, Pineapple, Cucumber & Lemon
- D4- Aloe Vera, Pineapple, Apple, Cucumber, Orange & Lime
- D5- Cucumber, Celery, Apple & Lime
- D6- Cucumber, Apple, Pineapple & Lime
ALL DAY - Protein Smoothies
- E1- Banana, Peanut Butter & Chocolate Protein
Made with Almond Milk (No sugar Added)
- E2- Pineapple, Banana, Spinach, Oatmeal & Protein
Made with Almond Milk (No sugar Added)
- E3- Strawberry, Blueberry, Almonds, Oatmeal & Protein
Made with Almond Milk (No sugar Added)
- E4- Banana, Blueberry, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E5- Papaya, Banana, Pecans, Almonds & Protein
Made with Almond Milk (No sugar Added)
- E6- Banana, Cantaloupe, Pecans, Walnuts & Protein
Made with Almond Milk (No sugar Added)
- E7- Blueberry, Banana, Oatmeal, Pecans & Protein
Made with Almond Milk (No sugar Added)
- E8- Mango, Banana, Peach, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E9- Mango, Apples, Kale, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E10- Beets, Blueberry, Kale, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
ALL DAY - Refreshers
- Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
- Orange Juice
- Lemonade
- Slushy Lemonade
- Watermelon Lemonade
Watermelon with Lime and a hint of Agave.
- Picante Watermelon
Watermelon, Tajin Powder & Agave *lightly spicy*
- Cucumber Refresher
Cucumber, Lime & Agave.
ALL DAY - Create Smoothie/ Juice🍋🍓
- 🍌Create Smoothie 🍓
- Create Juice 🍏
ALL DAY - Salads
- Chicken Greek Salad $12.95
Romaine Lettuce, Grilled Chicken, Black Olives, Tomatoes, Cucumbers, Red Onions, Peppers & Feta Cheese with Oil and Vinegar
- Chicken Caesar Salad $8.95
Romaine Lettuce, Grilled Chicken, Parmesan Cheese, Croutons & Ceasar Dressing
- Create Salad $3.50
- Fruit Salad
ALL DAY - Wraps
- California Wrap
Grilled Chicken, Fresh Mozzarella, Avocado, Lettuce, Tomato & Ranch Dressing
- Arizona Wrap
Chicken Cutlet, Monterrey Cheese, Jalapeños Peppers, Lettuce, Tomato & Mayo
- Monterrey Wrap
Chicken Cutlet, Monterrey Cheese, Turkey Bacon, Lettuce & Chipotle Sauce
- Caesar Wrap
Grilled Chicken, Parmesan Cheese, Crispy Lettuce, Croutons & Caesar Dressing
- Roma Wrap
Grilled Chicken, Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce
- Italian Wrap
Grilled Chicken, Cucumbers, Crispy Lettuce & Italian Dressing
ALL DAY - Paninis
- Pesto Panini
Grilled Chicken, Fresh Mozzarella, Roasted Peppers & Pesto Sauce
- Parmesan Panini
Chicken Cutlet, Fresh Mozzarella, Parmesan Cheese & Marinara Sauce
- Fajita Panini
Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa
- Tuna Melt
Tuna Salad, Mayo, Cheddar Cheese, Lettuce & Tomato
- Tuscan Panini
Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce
- Chicken Club
Grilled Chicken, Bacon, Lettuce, Tomato & Mayo
- Teriyaki Panini
Grilled Chicken, Zucchini, Squash, Carrots, Mozzarella Cheese & Teriyaki Sauce
ALL DAY - Quesadillas
- Chicken Quesadilla
Grilled Chicken & Mozzarella
- Fajita Quesadilla
Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa
- Vegetable Quesadilla
Fresh Mozzarella, Grilled Zucchini, Squash & Carrots
ALL DAY - Vegan Wraps
- Kaiser Wrap
Grilled Zucchini, Grilled Squash, Broccoli Rabe, Avocado & Chipotle Sauce on a Whole Wheat Wrap
- Summer Time Wrap
Veggie Patty, Cucumbers, Avocado, Roasted Peppers & Hummus on a Whole Wheat Wrap
- April Wrap
Chickpeas, Celery, Red Onions, Dried Cranberries, Vegan Mayo & Iceberg Lettuce on a Whole Wheat Wrap
ALL DAY - Burgers/ Heroes
- #1 Cheese Burger Deluxe $10.95
American cheese with Lettuce, tomato & French Fries
- #2 Bacon Cheese Burger Deluxe $12.95
- #3 Burger With Swiss, Grilled Onions, Grilled Mushroom & BBQ Sauce $12.95
Burger with Swiss, Grilled Onions, Grilled Mushrooms & BBQ Sauce
- #4 Burger With Muenster Cheese & Avocado $12.95
Burger with Muenster Cheese & Avocado
- Grilled Chicken Hero
Grilled Chicken, Muenster cheese, Avocado, Lettuce, Tomatoes and Ranch Dressing.
- Cajun Chicken Hero
Grilled Chicken, Onions, Peppers, Pepper Jack Cheese, Avocado, Lettuce, Tomatoes, chipotle mayo.
- Big Hero
Grilled chicken, Bacon, Muenster Cheese, Lettuce, tomato, Chipotle Mayo.
ALL DAY - Energy Shots
- Ginger Lemon Shot
Ginger & Lemon
- Power Shot
Ginger, Lemon, Cayenne Pepper & Turmeric
- Booster Shot
Beets, Garlic, Turmeric, Ginger & Lemon
- Vitamin C Shot
Grapefruit, Apple, Pineapple, Orange, Turmeric, Ginger & Lemon
ALL DAY - Sides/ Soups
- French Fries $4.00
- Chicken Empanada $3.00
- Cheese Empanada $3.00
- Sauce (1oz) $0.00
- Chicken & Vegetables Soup
- Lentil Soup
- Yogurt Muffins $2.95
ALL DAY - Drinks
- Can Soda $1.50
- Ice Cup
- Water Bottle $1.50
- Iced Coffee
Healthy Fresh Combinations
- A1- Mega Mix
Strawberry, Pineapple & Papaya with Evaporated Milk, Sugar Cinnamon & Vanilla
- A2- Berry Happy
Strawberry, Blueberry & Blackberry with Evaporated Milk, Sugar Cinnamon & Vanilla
- A3- Tropical Mix
Mango, Banana & Pineapple with Evaporated Milk, Sugar Cinnamon & Vanilla
- A4- Mango Tropical
Mango, Peach, Pineapple & Orange Juice
- A5- The Secret
Strawberry, Blueberry & Mango with Evaporated Milk, Sugar Cinnamon & Vanilla
- A6- Baby Bottle
Strawberry, Banana & Blueberry with Evaporated Milk, Sugar Cinnamon & Vanilla
- A7- Mango Tango
Mango & Orange Juice
- A8- Piña Colada
Pineapple & Coco Lopez
Energy Smoothies To Start Your Day
- B1- Incredible- Banana, Pineapple, Spinach, Apple & Cucumber
- B2- Mango, Strawberry, Raisins, Oatmeal, Agave & Almond Milk
- B3- Banana, Mango, Agave & Almond Milk
- B4- Strawberry, Pineapple, Mango, Agave & Almond Milk
- B5- Strawberry, Blueberry, Blackberry, Agave & Almond Milk
- B6- Papaya, Apple, Spinach, Agave & Orange Juice
- Morning Blast- Plum, Mango, Banana, Spinach, Ginger & Orange Juice
- Best DATE Ever! - Banana, Dates, Pecans, Almond Milk & Cinnamon
Build Your Immune System
- C1- Beet, Carrot & Orange
- C2- Pineapple, Apple & Ginger
- C3- Grapefruit, Orange, Pineapple & Ginger
- C4- Beet, Carrot, Apple, Celery & Ginger
- C5- Spinach, Beet, Carrot & Apple
- Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
Go Green To Be Clean
- D1- Aloe Vera, Pineapple, Apple & Cucumber
- Green Juice -D2- Spinach, Kale, Apple, Cucumber, Celery & Pineapple
- D3- Green Apple, Kale, Pineapple, Cucumber & Lemon
- D4- Aloe Vera, Pineapple, Apple, Cucumber, Orange & Lime
- D5- Cucumber, Celery, Apple & Lime
- D6- Cucumber, Apple, Pineapple & Lime
Protein Smoothies
- E1- Banana, Peanut Butter & Chocolate Protein
Made with Almond Milk (No sugar Added)
- E2- Pineapple, Banana, Spinach, Oatmeal & Protein
Made with Almond Milk (No sugar Added)
- E3- Strawberry, Blueberry, Almonds, Oatmeal & Protein
Made with Almond Milk (No sugar Added)
- E4- Banana, Blueberry, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E5- Papaya, Banana, Pecans, Almonds & Protein
Made with Almond Milk (No sugar Added)
- E6- Banana, Cantaloupe, Pecans, Walnuts & Protein
Made with Almond Milk (No sugar Added)
- E7- Blueberry, Banana, Oatmeal, Pecans & Protein
Made with Almond Milk (No sugar Added)
- E8- Mango, Banana, Peach, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E9- Mango, Apples, Kale, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E10- Beets, Blueberry, Kale, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
Refreshers
- Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
- Orange Juice
- Lemonade
- Slushy Lemonade
- Watermelon Lemonade
Watermelon with Lime and a hint of Agave.
- Picante Watermelon
Watermelon, Tajin Powder & Agave *lightly spicy*
- Cucumber Refresher
Cucumber, Lime & Agave.
Create Smoothie/ Juice🍋🍓
- 🍌Create Smoothie 🍓
- Create Juice 🍏
Salads
- Chicken Greek Salad $12.95
Romaine Lettuce, Grilled Chicken, Black Olives, Tomatoes, Cucumbers, Red Onions, Peppers & Feta Cheese with Oil and Vinegar
- Chicken Caesar Salad $8.95
Romaine Lettuce, Grilled Chicken, Parmesan Cheese, Croutons & Ceasar Dressing
- Create Salad $3.50
- Fruit Salad
Wraps
- California Wrap
Grilled Chicken, Fresh Mozzarella, Avocado, Lettuce, Tomato & Ranch Dressing
- Arizona Wrap
Chicken Cutlet, Monterrey Cheese, Jalapeños Peppers, Lettuce, Tomato & Mayo
- Monterrey Wrap
Chicken Cutlet, Monterrey Cheese, Turkey Bacon, Lettuce & Chipotle Sauce
- Caesar Wrap
Grilled Chicken, Parmesan Cheese, Crispy Lettuce, Croutons & Caesar Dressing
- Roma Wrap
Grilled Chicken, Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce
- Italian Wrap
Grilled Chicken, Cucumbers, Crispy Lettuce & Italian Dressing
Paninis
- Pesto Panini
Grilled Chicken, Fresh Mozzarella, Roasted Peppers & Pesto Sauce
- Parmesan Panini
Chicken Cutlet, Fresh Mozzarella, Parmesan Cheese & Marinara Sauce
- Fajita Panini
Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa
- Tuna Melt
Tuna Salad, Mayo, Cheddar Cheese, Lettuce & Tomato
- Tuscan Panini
Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce
- Chicken Club
Grilled Chicken, Bacon, Lettuce, Tomato & Mayo
- Teriyaki Panini
Grilled Chicken, Zucchini, Squash, Carrots, Mozzarella Cheese & Teriyaki Sauce
Quesadillas
- Chicken Quesadilla
Grilled Chicken & Mozzarella
- Fajita Quesadilla
Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa
- Vegetable Quesadilla
Fresh Mozzarella, Grilled Zucchini, Squash & Carrots
Vegan Wraps
- Kaiser Wrap
Grilled Zucchini, Grilled Squash, Broccoli Rabe, Avocado & Chipotle Sauce on a Whole Wheat Wrap
- Summer Time Wrap
Veggie Patty, Cucumbers, Avocado, Roasted Peppers & Hummus on a Whole Wheat Wrap
- April Wrap
Chickpeas, Celery, Red Onions, Dried Cranberries, Vegan Mayo & Iceberg Lettuce on a Whole Wheat Wrap
Burgers/ Heroes
- #1 Cheese Burger Deluxe $10.95
American cheese with Lettuce, tomato & French Fries
- #2 Bacon Cheese Burger Deluxe $12.95
- #3 Burger With Swiss, Grilled Onions, Grilled Mushroom & BBQ Sauce $12.95
Burger with Swiss, Grilled Onions, Grilled Mushrooms & BBQ Sauce
- #4 Burger With Muenster Cheese & Avocado $12.95
Burger with Muenster Cheese & Avocado
- Grilled Chicken Hero
Grilled Chicken, Muenster cheese, Avocado, Lettuce, Tomatoes and Ranch Dressing.
- Cajun Chicken Hero
Grilled Chicken, Onions, Peppers, Pepper Jack Cheese, Avocado, Lettuce, Tomatoes, chipotle mayo.
- Big Hero
Grilled chicken, Bacon, Muenster Cheese, Lettuce, tomato, Chipotle Mayo.
Energy Shots
- Ginger Lemon Shot
Ginger & Lemon
- Power Shot
Ginger, Lemon, Cayenne Pepper & Turmeric
- Booster Shot
Beets, Garlic, Turmeric, Ginger & Lemon
- Vitamin C Shot
Grapefruit, Apple, Pineapple, Orange, Turmeric, Ginger & Lemon
Sides/ Soups
- French Fries $4.00
- Chicken Empanada $3.00
- Cheese Empanada $3.00
- Sauce (1oz) $0.00
- Chicken & Vegetables Soup
- Lentil Soup
- Yogurt Muffins $2.95
Drinks
- Can Soda $1.50
- Ice Cup
- Water Bottle $1.50
- Iced Coffee
Healthy Fresh Details
Service options
- Delivery
- Takeout
- Dine-in
Highlights
- Great tea selection
Popular for
- Breakfast
- Lunch
- Dinner
- Solo dining
Accessibility
- Wheelchair accessible entrance
Offerings
- Coffee
- Healthy options
- Quick bite
- Small plates
- Vegan options
- Vegetarian options
Dining options
- Breakfast
- Brunch
- Lunch
- Dinner
- Dessert
- Table service
Atmosphere
- Casual
- Cozy
- Quiet
- Trendy
Crowd
- College students
Planning
- Accepts reservations
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
Parking
- Paid street parking
Healthy Fresh Photos










Healthy Fresh Location
Healthy Fresh
1033 Morris Park Ave, Bronx, NY 10461, USA
Healthy Fresh Reviews
priceswrappanininameempanadasdeliveryfriespeanut butterto gocheese empanada
★ 5★ 4★ 3★ 2★ 1Ordered here for the first time because I was craving a chicken caesar salad wrap. But I was VERY disappointed not only in the flavors of the food, but in the quantity for the price.This wrap was $13+ because I added French fries (which were $1.50). You can eat the wrap in 3 bites! The chicken was super dry and lacked flavor, the wrap barely had any dressing and tasted burnt. Absolutely terrible experience.. In the picture you will see half the wrap, and it’s smaller than the ginger ale. Barely had any filling. Do not order from here unless you want really small portions of mediocre food.Plenty of deli’s in the area that make better food, bigger portions & great pricing. This is what I get for being lazy and not heading to a worthy location.The healthy fresh owners should be ashamed of the mediocrity.
August 07 · Vianny GutierrezI had a great experience! The service was excellent — fast, friendly, and professional. Highly recommend!
March 16 · ༺ ÑÛRÛŁ Aɱιɳ ༻The name of the place is true. Healthy and fresh. The fruits and vegetables are fresh, the place is spotless. The people there are smart about the menu and friendly. Service is quick. They’re polite and forward with handling Bronx customers. Everything I order I’m so happy with. I’ve gotten Salads, Smoothies, Juices and I’m always pleased. Today I got a Toasted corn muffin with butter and that was sooo yummy. They have seating. The prices are on point for top quality food and service.
June 07 · Kimberly RobinsonI love how this place looks. The glass wall in the early morning looks stunning. The place looks appealing. There's always plenty of staff to get you your order quick. I was sick so I went here in the early winter. I hadn't had breakfast and I ordered a chocolate chip muffin. The way they toasted it and buttered it is still the best muffin I ever had. I can't believe I haven't been back. It was amazing. This place is great.
September 04 · Morris TravelerLove getting my lunch from healthy fresh. Their smoothies are the best and they always pay close attention to my allergies before sending it. Their chicken Caesar wrap is 10/10.
May 02 · Teresa Goggin
More Best Restaurants Near Me
Osaka sushi4.0 (84 reviews)1041 Morris Park Ave, Bronx, NY 10461, USA
Nana's Kitchen4.0 (209 reviews)1809 Hone Ave, Bronx, NY 10461, USA
Morris Park Inn4.0 (189 reviews)1024 Morris Park Ave, Bronx, NY 10461, USA
Emilio's of Morris Park4.0 (1274 reviews)1051 Morris Park Ave, Bronx, NY 10461, USA
Addeou2019s of the Bronx4.0 (548 reviews)1056 Morris Park Ave, Bronx, NY 10461, USA
Lucianou2019s Pizza4.0 (262 reviews)1005 Morris Park Ave # A, Bronx, NY 10462, USA
Aguilaru2019s Mexican Grocery4.0 (194 reviews)1060 Morris Park Ave, Bronx, NY 10461, USA
La Masa Restaurant4.0 (1360 reviews)1000 Morris Park Ave, Bronx, NY 10462, USA
Prizreni Grill4.0 (45 reviews)1080 Morris Park Ave, Bronx, NY 10461, USA
Patsy's Pizzeria Morris Park4.0 (499 reviews)980 Morris Park Ave, Bronx, NY 10462, USA
Golden Eagle Restaurant4.0 (466 reviews)975 Morris Park Ave, Bronx, NY 10462, USA
Patricia's of Morris Park4.0 (350 reviews)1082 Morris Park Ave, Bronx, NY 10461, USA
Categories
Top Visited Sites
sweetgreen4.0 (690 reviews)
Geisha4.0 (916 reviews)
BIBIBOP Asian Grill4.0 (1113 reviews)
Z Cucina di Spirito4.0 (655 reviews)
El Tacontento4.0 (10 reviews)
14 Street Halal Food4.0 (46 reviews)Trending Bites & Banter Posts
Your Ultimate Guide to Fine Dining | Explore the Art of Gourmet Meals
Food Trends: Tips, Trends, and Secrets - Stay Ahead in 2025
From Street Eats to Fine Dining: Dessert Spots
Why Vegan Restaurants That Deliver on Flavor and Atmosphere Matter
Exploring Foodie Guides Perfect for Date Night: A Culinary Adventure
Exploring Fine Dining That Will Satisfy Every Craving Across the U.S.
