NAYA Introduce
Welcome to NAYA, a culinary gem nestled in the heart of New York City, where the vibrant flavors of the Middle East come to life. In a city bustling with endless dining options, NAYA stands out as a true destination for authentic Lebanese cuisine. This isn't just another restaurant; it's a place where tradition meets convenience, offering a menu that’s both deeply rooted in Middle Eastern culinary heritage and perfectly suited for the fast-paced New York lifestyle. For those of us living and working in the city, finding a spot that offers a quick, healthy, and genuinely satisfying meal can be a challenge. NAYA rises to that challenge, providing a welcoming, casual atmosphere where you can enjoy a delicious and wholesome meal, whether you're grabbing a quick lunch or settling in for a relaxed dinner.
NAYA prides itself on its commitment to quality and authenticity. The menu is a thoughtful curation of classic Lebanese dishes, each prepared with fresh ingredients and a passion for flavor. From the moment you step inside, you're greeted with the tantalizing aromas of spices, grilled meats, and freshly made bread. The friendly staff is always ready to guide you through the menu, making it easy to discover new favorites or customize a meal just the way you like it. Whether you're a seasoned enthusiast of Middle Eastern food or new to the cuisine, NAYA offers an accessible and delightful experience that will leave you wanting more.
NAYA is conveniently located at 916 8th Ave, New York, NY 10019, USA. Its prime location in the Midtown area makes it an ideal spot for locals, tourists, and anyone exploring the city. Being situated on 8th Avenue means it's easily accessible via a variety of public transportation options. Many subway lines serve this part of town, so you can easily reach NAYA whether you're coming from another borough or a different part of Manhattan. For those driving, paid street parking is available, though as with any busy part of NYC, it can be competitive. The central location makes it a great meeting point for friends and colleagues, and it's a perfect pre-theater dinner spot given its proximity to the Broadway district. The restaurant's presence on this major avenue ensures that it's a noticeable and easy-to-find destination for anyone in the area.
NAYA offers a variety of services to accommodate every type of diner. Whether you're in a rush or looking to relax, they have you covered.
- Takeout: For those on the go, NAYA offers convenient takeout services. You can call ahead to place an order or simply stop by to pick up your meal. This is a great option for office workers grabbing lunch or families bringing a delicious meal home for dinner.
- Dine-in: The restaurant features comfortable seating where you can enjoy your meal in a casual, relaxed atmosphere. The interior is designed to be a bright and welcoming space, making it a great place to sit down and unwind.
- Catering: NAYA’s delicious food is perfect for events and gatherings of all sizes. They offer catering services, bringing the authentic flavors of Lebanese cuisine to your next party, corporate lunch, or special occasion.
- Dessert: Don't forget to save room for dessert! NAYA offers a selection of sweet treats, including their popular baklava, to finish off your meal on a high note.
NAYA stands out for a variety of features that make it a local favorite. From the delicious food to the welcoming environment, here's what makes NAYA special.
- A wide variety of offerings: NAYA's menu is incredibly versatile, catering to different tastes and dietary needs. They are known for their
comfort food ,healthy options ,quick bites , andsmall plates . Their menu includes a 'Create Your Own' section with options like the NAYA Roll, NAYA Bowl, and NAYA Salad, allowing you to customize your meal with a choice of proteins, bases, and toppings. - Authentic Lebanese Flavors: The food at NAYA is lauded for its authenticity. As one reviewer mentioned, a partner from Lebanon was thrilled to find that the
fatayers taste right , which is a testament to the restaurant's commitment to traditional recipes and flavors. The hummus, baba ghannouj, and other dips are made with care and are a favorite among customers. - Friendly and efficient service: NAYA is well-known for its
friendly service . The staff is welcoming and helpful, ensuring that every customer has a pleasant dining experience. This commitment to great service contributes to the positive and light ambiance of the restaurant. - Generous portions: Customers consistently praise the
great portions at NAYA. You can expect a satisfying and filling meal that provides excellent value for your money, whether you order a customizable bowl or a selection of appetizers. - Family-friendly atmosphere: The restaurant is
good for kids and offershigh chairs , making it a great choice for a family outing. The casual and laid-back atmosphere ensures that everyone feels comfortable. - Convenient payment options: NAYA makes it easy to pay for your meal, accepting both
credit cards anddebit cards .
Contact Information:
- Address: 916 8th Ave, New York, NY 10019, USA
- Phone: (212) 597-9156
Why is NAYA worth choosing for your next meal in New York City? The answer lies in its ability to deliver an authentic, high-quality dining experience without the pretense. In a city where quick food can often mean a compromise on quality, NAYA offers a refreshing alternative. It’s a place where you can get a delicious, healthy meal that feels both fast and substantial. The 'Create Your Own' options are a major draw, allowing you to build a meal that perfectly fits your preferences, whether you're a fan of quinoa, vermicelli rice, or a crisp salad base. The extensive selection of hot and cold appetizers, from the tangy
Beyond the food, NAYA's atmosphere is a significant reason for its popularity. It’s a
Ultimately, NAYA represents a perfect fusion of traditional Middle Eastern flavors and modern dining convenience. It’s a restaurant that has earned its reputation by consistently providing flavorful food, generous portions, and a welcoming environment. For anyone in New York looking for a quick and satisfying lunch, a relaxed dinner with friends, or a taste of authentic Lebanese cuisine, NAYA is a destination that truly delivers. Its dedication to quality, authenticity, and customer satisfaction makes it a standout choice in a city known for its diverse and competitive food scene.
NAYA Menu
Extras
- Tri-Color Quinoa $3.29
Fluffy and earthy white, red, and black quinoa grains
- Toum (Garlic Whip) $0.69
- Pita Bread $1.29
- NEW! Pomegranate Tahini $0.69
A delicious blend of tahini and pomegranate molasses, offering a rich, nutty base with a sweet-tart finish.
- Vermicelli Rice $3.29
white, medium grain with vermicelli
- Lemon Tahini $0.69
Sesame base
- Spicy Red Pepper Sauce $0.69
Mild, tomato base
- Pita Chips $4.29
White & whole wheat chips with zaatar, sumac
- Side Of Protein $4.29
- Zesty Jalapeño Sauce $0.69
Jalapeño base
Sweets
- NEW! Cashew Baklava $4.30
Crispy, rolled phyllo fingers filled with cashews and hints of lemon, rose water, and orange blossom.
- NEW! Pistachio Baklava $5.30
A crispy sweet pastry made of layers of phyllo filled with pistachio and hints of lemon, rose water, and orange blossom.
NEW | featured salad
- Roasted Lemon Chicken Salad $16.95
Tender chicken marinated in spices and New York Shuk Preserved Lemon, roasted to perfection and served over seasonal mixed greens with tomatoes, cucumbers, yogurt cucumber sauce, crumbled feta, SIMPLi Kalamata olives, lemon wedge and tangy sumac onions. Paired with pomegranate tahini on the side for a bright, flavorful finish.
Create Your Own
- NAYA Roll $12.59
Build-Your-Own: Daily baked pita bread with your choice of protein, toppings and homemade sauces.
- NAYA Bowl $13.99
Build-Your-Own: Vermicelli rice or Quinoa rice with your choice of protein, toppings, and homemade sauces.
- NAYA Salad $13.99
Build-Your-Own: Romaine lettuce or Spinach, Arugula & Cabbage mix with your choice of protein, toppings and homemade sauces
Hot Appetizers
- Kibbe $2.30
Fried beef dumplings stuffed with minced beef and pine nuts (1 pc)
- Fatayer $1.80
Mini pie with spinach, lemon and sumac (1 pc)
- Rekakat $2.30
Blend of three Mediterranean cheeses, wrapped in phyllo and deep fried (1 pc)
- Falafel Pcs $1.10
Fried chickpea croquette, herbs, spices (1 pc)
Cold Appetizers
- Toum Garlic Whip $5.29
Our Toum (garlic whip) is a creamy, bold spread that adds a punch of flavor to any roll, bowl, or salad.
- Labne Dip $5.29
Strained yogurt dip
- Baba Ghannouj Dip $5.29
Roasted eggplant puree, imported tahini and lemon
- Spicy Hummus Dip $5.29
Chickpea puree, imported tahini and jalapeno
- Tabboule $5.29
Half portion. Parsley, mint, bulgur, tomato, onion, lemon and olive oil
- Grape Leaves $6.29
Stuffed with parsley, onion, tomato and rice
- Hummus Dip $5.29
Chickpea puree, imported tahini and lemon
- Cucumber Yogurt Dip $5.29
Diced cucumber yogurt and dry mint
- Cabbage Slaw Salad $4.29
Cabbage salad, dry mint, lemon, olive oil
Ultimate appetizer bundle
- Ultimate Appetizer Bundle $115.00
Serves 6-8 | Includes 1 dozen hot appetizers, 1 cold appetizer tray served with pita chips or pita bread, and 1 dozen pita pockets – all the favorites in one bundle!
Beverages
- Open Water Sparkling $3.60
- Spindrift Orange Mango $3.60
- Gold Peak Ice Tea $4.10
A high quality ready-to-drink iced tea with an authentic home brewed taste.
- Spindrift Raspberry Lime $3.60
- Spindrift Grapefruit $3.60
- Open Still Water $3.60
- Canned Soda $3.10
NAYA Details
Service options
- Takeout
- Dine-in
Popular for
- Lunch
- Dinner
- Solo dining
Accessibility
- Wheelchair accessible parking lot
Offerings
- Comfort food
- Healthy options
- Quick bite
- Small plates
Dining options
- Lunch
- Dinner
- Catering
- Dessert
- Seating
Atmosphere
- Casual
Payments
- Credit cards
- Debit cards
Children
- Good for kids
- High chairs
Parking
- Paid street parking
NAYA Photos










NAYA Location
NAYA Reviews
bowlpricelunchattentionwrapgarlicnamefalafelpaperefficiency
★ 5★ 4★ 3★ 2★ 1Had a salad bowl, service was great, the place is light & nice ambience. Food tasted great but unfortunately the whole thing was overly greasy/oily (I had dressing on the side in a tub & didn't pour it in), some of the components of the toppings are already dressed in oil & it was too much for my taste.
May 03 · J-Rocks!I love this place! It was so great to take my partner, who is Lebanese, here and watch her eyes light up when she looked at the menu. She says "the fatayers taste right!"The service is friendly and the portions are great.
February 11 · Andrew PoppeDecided to give this place another try and it was worse than last time. Service is extremely slow and rude, my wrap got ripped open in the press and instead of fixing it they just slopped it into the paper and wrapped it up. Certainly not worth $15. There's plenty of better places in the area.
June 07 · Frank VeneziaFood is excellent lunch takeout food in the area. Flavorful, and great value for cost (they give you a lot of protein and toppings). Just be careful with how much toum you add because it is easy to over do it.
August 20 · Carolyn De MeloI have never had Naya before so I wasn't really sure what to get but Gavin who works at the store was super nice and shared what some of his favorite items were.I ended up getting a bowl with half rice and half lettuce and some of the items Gavin recommended like the chicken kebab, pickled lettuce, garlic sauce, pickled onions, and tzatziki.Everything was delicious!The store was nice and clean with a lot of seating as well. There was another staff member who helped me during check out and he was very nice too so service was great in general at this store location.
January 27 · April L
More Best Restaurants Near Me
Chick-fil-A4.0 (1608 reviews)918 8th Ave, New York, NY 10019, USA
Mama Halal Food4.0 (137 reviews)W 54th St &, 8th Ave, New York, NY 10019, USA
Sammy's Halal Food2.0 (40 reviews)922 8th Ave, New York, NY 10019, USA
Kyoto Hibachi4.0 (60 reviews)917 8th Ave, New York, NY 10019, USA
Le Pain Quotidien4.0 (846 reviews)250 W 55th St, New York, NY 10019, USA
Subway3.0 (134 reviews)925 8th Ave, New York, NY 10019, USA
Chai Kitchen4.0 (1279 reviews)930 8th Ave, New York, NY 10019, USA
The Original Soup Kitchen4.0 (1047 reviews)259A W 55th St, New York, NY 10019, USA
Nocello4.0 (381 reviews)257 W 55th St, New York, NY 10019, USA
The Grisly Pear - Midtown4.0 (339 reviews)243 W 54th St, New York, NY 10019, USA
Donburiya4.0 (1002 reviews)253 W 55th St, New York, NY 10019, USA
Soba Noodle Azuma4.0 (859 reviews)251 W 55th St, New York, NY 10019, USA
Categories
Top Visited Sites
Columbus Brewing Company Beer Hall4.0 (692 reviews)
Chef's Salad Columbus5.0 (3 reviews)
Buckeye Asian Express4.0 (166 reviews)
Polash4.0 (264 reviews)
New Wonjo4.0 (2552 reviews)
Chili's Grill & Bar4.0 (1042 reviews)Trending Bites & Banter Posts
From Street Eats to Fine Dining: Exploring the Best Rooftop Restaurants
Street Food That Are Loved by Locals: Discover Popular Local Street Foods Around the World
Exploring Food Festivals Foodies Can’t Stop Talking About: Must-Visit Events
How to Find Restaurant Reviews That Are Worth Traveling For
Romantic Dining Every Food Lover Should Know: A Guide to Memorable Experiences
From Street Eats to Fine Dining: Exploring the Best Steakhouses
