Popeyes Louisiana Kitchen Introduce
Welcome to the heart of the Bronx, where the vibrant flavors of Louisiana come to life at Popeyes Louisiana Kitchen. As a beloved staple in the fast-food landscape of New York, this location at 3411 Jerome Ave offers more than just a quick meal; it provides a taste of authentic Cajun and Creole-inspired cuisine right in your neighborhood. Renowned for its signature fried chicken, this restaurant has become a go-to spot for those seeking delicious, flavorful, and satisfying comfort food. Whether you're a local resident, a student from a nearby college, or a visitor exploring the area, Popeyes on Jerome Ave promises a friendly and efficient dining experience that caters to all tastes and schedules. It's a place where you can grab a quick bite during lunch, enjoy a full family dinner, or satisfy a late-night craving, all while enjoying the relaxed and casual atmosphere that has made Popeyes a global icon.
This particular Popeyes location is not just a place to eat; it's a part of the local community. It stands out for its commitment to serving up fresh, high-quality food that stays true to the brand's Louisiana roots. From the moment you step inside, the inviting aroma of their signature spices and freshly prepared food greets you, promising a meal that is both comforting and exciting. The restaurant's reputation is built on consistency and quality, making it a reliable choice for anyone looking for a great meal without the fuss.
The experience at this Popeyes is designed to be convenient and enjoyable. With a menu that features a wide range of options—from their iconic Signature Chicken and handcrafted tenders to seafood selections and a variety of sides—there’s something for everyone. It's a place that's popular for a reason, attracting a diverse crowd of college students, families, and tourists alike who are all in search of that unique Popeyes flavor. The team here works hard to maintain a high standard of service and food quality, ensuring that each visit is a pleasant one. The casual and family-friendly environment makes it a perfect spot for any occasion, from a solo lunch to a gathering with friends or family.
Located at 3411 Jerome Ave in the Bronx, this Popeyes Louisiana Kitchen is easily accessible for both locals and those passing through the area. Situated in a bustling part of the borough, it’s a convenient stop whether you’re traveling by car or public transit. For drivers, the restaurant offers the added benefit of a free parking lot, which is a significant convenience in a busy urban area like New York. There is also free street parking available nearby, providing more options for those driving to the location. The accessibility of the site extends beyond just transportation. The restaurant is fully wheelchair accessible, with a wheelchair accessible entrance, restroom, and seating, ensuring that all guests can dine comfortably. This commitment to accessibility makes it a welcoming and inclusive space for everyone in the community.
For those who prefer not to drive, the location is well-served by public transportation routes, making it easy to get to from various parts of the Bronx and beyond. Its prominent position on Jerome Ave makes it a recognizable landmark, simplifying the task of finding it. Whether you're coming from a day of shopping, heading home from work, or simply exploring the neighborhood, this location's prime spot ensures it’s always within reach. The combination of convenient parking and public transit access solidifies its status as a top choice for a quick and satisfying meal.
The services offered at Popeyes Louisiana Kitchen are designed with customer convenience in mind, providing multiple ways to enjoy your favorite meals.
In-Person Dining: The restaurant offers a casual and comfortable dining area with ample seating for individuals, families, and groups. It's a great place to sit down, relax, and enjoy your meal in a clean and welcoming environment.
Takeout: For those on the go, the takeout service allows you to quickly pick up your order and enjoy it at home, at work, or anywhere else. It’s perfect for a quick lunch or dinner when you’re short on time.
Delivery and No-Contact Delivery: In partnership with various delivery services, Popeyes brings their delicious food right to your doorstep. The no-contact delivery option provides an extra layer of safety and convenience, allowing you to enjoy your meal without any direct interaction.
Outdoor Seating: On a nice day, you can choose to enjoy your meal at the outdoor seating area. This is a great option for those who prefer to dine al fresco and enjoy the fresh air.
Catering: For events, parties, or office gatherings, Popeyes offers catering services, making it easy to share their famous chicken and sides with a large group. It’s a surefire way to please a crowd.
Counter Service: The efficient counter service ensures that your order is taken quickly and accurately, minimizing wait times and getting you your food in a timely manner.
This Popeyes location is celebrated for several key features and highlights that enhance the customer experience.
Wheelchair Accessibility: The restaurant is committed to being accessible to everyone, with a wheelchair accessible entrance, seating, and restroom.
Free Wi-Fi: Guests can enjoy complimentary Wi-Fi, making it a great place to get some work done, study, or simply browse the internet while you eat.
Family-Friendly and Kids' Menu: The atmosphere is casual and welcoming to families, and there’s a dedicated kids' menu with options that are sure to please even the pickiest eaters.
Late-Night Food and Quick Bites: Serving as a perfect spot for late-night cravings, this location offers quick and satisfying meals that are ideal for those who work late or are out and about in the evening.
Varied Menu Offerings: Beyond the famous chicken, the menu includes a range of offerings like seafood (including the popular Popcorn Shrimp), flavorful sides, and delicious desserts like the Cinnamon Apple Pie.
For all inquiries or to place an order, you can contact the restaurant using the following information:
Address: 3411 Jerome Ave, Bronx, NY 10467, USA
Phone: (929) 222-5000
In the bustling New York food scene, what makes Popeyes Louisiana Kitchen worth choosing? It’s a combination of their unique flavor profile, quality ingredients, and the convenience they offer. The restaurant specializes in comfort food with a distinctive Cajun twist, setting it apart from other fast-food options. Their signature chicken is marinated for at least 12 hours, ensuring every piece is juicy and flavorful, and the hand-battered and breaded process creates that perfect, crispy exterior that Popeyes is famous for.
One of the most compelling reasons to visit is the depth and variety of the menu. From their classic Signature Chicken to their popular chicken sandwiches, which have become a cultural phenomenon, there’s always something new and exciting to try. The menu also caters to different preferences, with options like Handcrafted Tenders, a variety of seafood dishes, and a selection of delicious sides such as their famous Mashed Potatoes with Cajun Gravy, Cajun Fries, and Homestyle Mac & Cheese. The desserts, like the Strawberry Cream Cheese Pie, provide a perfect sweet finish to any meal. The availability of group meals and bundles also makes it an excellent choice for feeding a crowd without breaking the bank.
Beyond the food, the location’s commitment to service is a key factor. They accept a variety of payment methods, including credit cards, debit cards, and NFC mobile payments, making transactions quick and easy. The atmosphere is casual and inviting, making it a comfortable place for people from all walks of life. While there might occasionally be a wait, it’s a testament to the food’s popularity and the restaurant's quality. This Popeyes location embodies the spirit of a true neighborhood eatery, providing a consistent and enjoyable experience that keeps customers coming back for more. It’s a place where you can count on getting a fresh, hot meal with that unmistakable Popeyes flavor.
Popeyes Louisiana Kitchen Food & drink
Beverages
- Soft Drinks $0.00
- Chilled Lemonades $5.49
- Frozen Lemonades $5.49
- Iced Teas $0.00
Signature Chicken
- 8Pc Signature Chicken $27.99
[Feeds 3-4] 8 pieces of Popeyes' signature seasoned and fried chicken. Perfectly portable protein.
- 16Pc Signature Chicken $49.99
[Feeds 6-8] 16 big pieces of the signature chicken to satisfy the heartiest appetites. A family-sized feast!
- 12Pc Signature Chicken $39.99
[Feeds 4-6] A hefty serving of 12 pieces of that signature, juicy fried chicken. Enough for all!
New & Limited Time Offerings
- Classic Wrap $4.79
Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and classic mayo, all wrapped in a soft flour tortilla.
- Spicy Wrap $4.79
Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and spicy mayo, all wrapped in a soft flour tortilla.
- Honey Mustard Wrap $4.79
Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and honey mustard sauce, all wrapped in a soft flour tortilla.
- Wrap Regular Combo $10.79
Choose a wrap of your choice (Classic, Spicy or Honey Mustard). Served with 1 side and 1 drink.
- Fansville Wings Deal $17.49
Get a regular fountain drink for free when you buy 12pc wings.
Tenders
- 12Pc Handcrafted Tenders $39.99
[Feeds 4-6] 12 chicken tenders marinated and fried with Louisiana herbs and seasonings. Includes 4 dipping sauces.
- 3Pc Handcrafted Tenders $13.99
3 chicken tenders of your choice marinated and fried with Louisiana herbs and seasonings. Includes 1 dipping sauce
- 5Pc Handcrafted Tenders $16.99
5 chicken tenders of your choice marinated and fried with Louisiana herbs and seasonings. Includes 2 dipping sauces
- 16Pc Handcrafted Tenders $49.99
[Feeds 6-8] A hearty serving of 16 handcrafted tenders with 5 dipping sauces. Twice the tender fun!
Combos
- 3Pc Signature Chicken Combo $17.49
Three pieces of the signature chicken coupled with a tasty side, buttermilk biscuit and a drink. Satisfaction guaranteed.
- ¼ Pound Popcorn Shrimp Combo* $14.99
Quarter pound of crispy popcorn shrimp with a side, buttermilk biscuit, and a drink. Shrimp never tasted so good!
- Classic Chicken Sandwich Combo $14.99
The classic sandwich paired with a side and drink. An iconic combo meal.
- 2Pc Signature Chicken Combo $13.99
Two pieces of Popeyes' signature juicy, seasoned chicken with a side, buttermilk biscuit and a drink. Simple perfection.
- 4Pc Signature Chicken Combo $19.99
Four pieces of that signature chicken goodness served with a side, buttermilk biscuit and a drink. Plenty to savor.
- 5Pc Tenders Combo $19.99
5 handcrafted tenders complemented by a side, drink and a buttermilk biscuit. Satisfying simplicity.
- 6 Classic Boneless Wings Combo $13.99
6 boneless crispy chicken wings with your choice of flavor. Served with 1 regular side and 1 drink. Includes 1 dipping sauce. Don't miss our new Pickle Glaze Wings marinated in Louisiana herbs and a tangy dill blend and fried to pickle perfection to make a delicious Cajun-pickled duo.
- Ghost Pepper Sandwich Combo $14.99
Our buttermilk battered all white meat chicken breast featuring our all-new Ghost Pepper Sauce. Served on a butter toasted brioche bun with barrel cured pickles. Served with 1 regular side and 1 drink.
- 6 Classic Bone-In Wings Combo $13.99
6 Crispy, golden chicken wings marinated in a lightly seasoned mild blend, then hand-breaded and fried to perfection. These wings deliver the ideal balance of crunch and flavor —perfect for those who love bold taste without the heat. Served with 1 regular side and 1 drink.
- Spicy Chicken Sandwich Combo $14.99
The spicy chicken sandwich with a side and drink to cool things down.
- 3Pc Tenders Combo $17.49
3 handcrafted tenders with a side, drink and a buttermilk biscuit. A compact taste of tender perfection.
Seafood
- ¼ Pound Popcorn Shrimp* $11.99
Quarter pound of our crispy popcorn shrimp.
- Surf N Turf $6.79
The Surf 'n Turf features four tender, crispy Butterfly Shrimp and two chicken tenders, all seasoned in a traditional blend of Louisiana herbs and spices and choice of sauce
- Shrimp Tackle Box $8.99
8 crispy butterfly shrimps served with 1 regular side and 1 buttermilk biscuit. Includes 1 dipping sauce.
Signature Sides and Sauces
- Dipping Sauces $0.30
- Mashed Potatoes With Cajun Gravy $4.99
Velvety mashed potatoes smothered in savory Cajun-style gravy. A rich indulgence.
- Cajun Fries $4.99
Fries seasoned with authentic Cajun spices, delivering a bold and savory kick.
- Coleslaw $4.99
A crisp and tangy cabbage slaw, adding a fresh crunch to your meal.
- Homestyle Mac & Cheese $5.99
Creamy, cheesy macaroni baked to golden perfection. A comforting classic.
- Biscuit $1.99
Freshly baked buttermilk biscuits, flaky on the outside and soft on the inside - a perfect pairing.
- Wing Sauces $0.90
- Red Beans & Rice $4.99
Flavorful red beans served over a bed of seasoned rice. A taste of Louisiana.
Desserts
- Strawberry Cream Cheese Pie $2.99
Crispy fried pie filled with strawberry and cream cheese
- Cinnamon Apple Pie $2.29
A warm, crispy pie crust encasing a gooey cinnamon-apple filling. Comfort in every bite.
- Caramel Apple Cheesecake $4.49
Indulge in rich cheesecake swirled with a sweet and tangy caramel apple filling over a buttery graham cracker crust.
Group Meals
- 16Pc Signature Chicken Family Meal $65.99
[Feeds 6-8] 16 pieces of juicy signature chicken with 3 large sides and 8 buttermilk biscuits.
- Wings & Sandwiches Bundle $23.99
12 wings (up to 2 flavors). Choose bone-in or boneless or mix the two! 2 sandwiches, and a large side. A crowd-pleasing combo!
- Wings 2 Can Dine $17.99
6 wings (bone-in or boneless), 3 tenders, 2 sides, and 2 biscuits. A hearty meal for two to enjoy together.
- 8Pc Signature Chicken Family Meal $41.99
[Feeds 3-4] 8 juicy pieces of signature chicken paired with a large side and 4 buttermilk biscuits - a classic meal.
- 12Pc Signature Chicken Family Meal $53.99
[Feeds 4-6] 12 pieces of signature chicken with 2 large sides and 6 buttermilk biscuits to satisfy the whole family.
Chicken Sandwiches
- Classic Chicken Sandwich $7.99
A fried chicken breast filet with pickles and classic mayo on a buttered bun. The original handheld favorite.
- Spicy Chicken Sandwich $7.99
A kicked-up fried chicken sandwich with pickles and spicy mayo on a buttered bun. A fiery fan favorite!
- Ghost Pepper Sandwich $7.99
Our buttermilk battered all white meat chicken breast featuring our all-new Ghost Pepper Sauce. Served on a butter toasted brioche bun with barrel cured pickles.
Popeyes Louisiana Kitchen Details
Service options
- Outdoor seating
- No-contact delivery
- Delivery
- Takeout
- Dine-in
Popular for
- Lunch
- Dinner
- Solo dining
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible restroom
- Wheelchair accessible seating
Offerings
- Comfort food
- Late-night food
- Quick bite
- Small plates
Dining options
- Lunch
- Dinner
- Catering
- Counter service
- Dessert
- Seating
- Table service
Amenities
- Restroom
- Wi-Fi
- Wi-Fi
Atmosphere
- Casual
Crowd
- College students
- Family-friendly
- Groups
- Tourists
Planning
- Usually a wait
- Accepts reservations
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
- Kids' menu
Parking
- Free parking lot
- Free street parking
Popeyes Louisiana Kitchen Photos










Popeyes Louisiana Kitchen Location
Popeyes Louisiana Kitchen
3411 Jerome Ave, Bronx, NY 10467, USA
Popeyes Louisiana Kitchen Reviews
managerpriceschicken sandwichcashierfriescleanspicymoneybiscuitsbag
★ 5★ 4★ 3★ 2★ 1⭐️⭐️⭐️⭐️⭐️Amazing Experience!I had a wonderful time The food was absolutely delicious – fresh, flavorful, and perfectly cooked. Every dish I tried was well-prepared and beautifully presented.The service was top-notch. The staff were friendly, attentive, and made sure we had everything we needed without being too intrusive. They really made us feel welcome.The atmosphere was cozy and inviting, with a clean and stylish interior that made the whole experience even better. Whether you’re dining with friends or on a date, it’s a great place to relax and enjoy good food.Highly recommend – I’ll definitely be coming back!
July 12 · DEEP CBI wanted to use my receipt but I have a funny feeling the worker did not give me a receipt. I never throw anything away however I cannot find the receipt. I am a big fan of Popeyes. But as of late, every time I order food I’m always expecting the fresh food I used to receive. I ordered 3 pieces of chicken. A breast, thigh, and leg spicy. But lately like today, the food appears to be suspect. I feel that either the the chicken was some old chicken from Kennedy Chicken next door the way it looked and tasted. I took a bite and right away I was turned off. I could not eat the rest. The young lady was not nice at all. I’ve seen her there for a while now and every time I come, I’m sorely disappointed in her demeanor and the fact that she always gives me this old disgusting chicken. I’m very unhappy about it because I love Popeyes chicken. But even when management likes to serve old food, I’m just disgusted by the quality of service. I feel the same way about Popeyes on Kingsbridge Road and Web Avenue. I had a similar experience the other day in front of the manager. There was no reprimand. I’m certain there was none later either. I’m certain the manager encourages the staff to save a penny and serve old food. I ordered a small order of rice and beans and they literally mixed the old rice with new rice. The old rice was hard. So I asked for a refund. Luckily, I tasted the food before I got home. These things can make a customer very angry to spend so much money on a small old serving of rice and beans. It almost makes me hope that Popeyes will just close down. I’m certain if nothing is done, Popeyes in New York is definitely headed that way. It’s so unfortunate because it’s a place I’ve frequented all my life since the 70s. I had Popeyes in Ohio. Unlike these Popeyes, the staff was somewhat diverse and the food was great. It took a little while to get it but it was fresh and tasty and the staff could identify with me as an American and they refused to serve me some old disgusting food just because they want to save a buck. The chicken I got this afternoon is the chicken below.
January 06 · Lisa CombsButterfly shrimp was so crispy and delicious. Also, the fries were so good. However, the service was very fast as well as the behavior of the employees was very warming.
July 12 · Nabil HossainI bought a spicy chicken combo and the chicken is crispy, juicy, and perfectly seasoned. The service was fast and the staff were friendly and helpful. I’ll definitely be coming back for the spicy chicken!
July 12 · Sabbir AhmedI went in there during my lunch break , as I walked in I noticed it was empty which I expected to me in & out with my order. The lady there did not bother to greet me & continue packing an order. 2 Uber driver walked in & she gave them the order for pick up. I continue to patiently wait since but not once did she look at me or at least say “ I’ll be right with you “ or at least something. Another uber driver walks in & she continue taking them instead. I walked out since she seems to only do pick up orders.
April 30 · Jennifer Labra
More Best Restaurants Near Me
Kennedy Fried Chicken & Salads4.0 (241 reviews)3413 Jerome Ave, Bronx, NY 10467, USA
Taco Express Mexican Grill4.0 (820 reviews)3403 Jerome Ave, Bronx, NY 10467, USA
Los Munchies Jerome Ave3.0 (114 reviews)3421 Jerome Ave, Bronx, NY 10467, USA
Corner Pizza4.0 (203 reviews)3399 Jerome Ave, Bronx, NY 10467, USA
Chipotle Mexican Grill2.0 (36 reviews)3431 Jerome Ave, Bronx, NY 10467, USA
Wok Wok Chinese Restaurant3.0 (221 reviews)5 E 208th St, Bronx, NY 10467, USA
Bronx NY Pizza4.0 (109 reviews)3414 Jerome Ave, Bronx, NY 10467, USA
Happy Dragon4.0 (236 reviews)3388 Jerome Ave, Bronx, NY 10467, USA
Jimy's Pizza Corp4.0 (182 reviews)7 E 208th St, Bronx, NY 10467, USA
$1 Slice Pizza4.0 (52 reviews)3414 Jerome Ave, Bronx, NY 10467, USA
M & R Pizza3.0 (32 reviews)7 E 208th St, Bronx, NY 10467, USA
Teriyaki One Japanese Grill (Teriyaki & Sushi)4.0 (170 reviews)6 E 208th St, Bronx, NY 10467, USA
Categories
Top Visited Sites
Chanson New York4.0 (622 reviews)
O Ramen & Dim Sum M Yuki Sushi4.0 (245 reviews)
Ocean Restaurant3.0 (44 reviews)
Bakersfield Short North4.0 (1732 reviews)
Bestin Foodservice4.0 (5 reviews)
Hai Poké Food Truck2.0 (1 reviews)Trending Bites & Banter Posts
From Street Eats to Fine Dining: Dessert Spots | Brunch & Snack Chat
Your Ultimate Guide to Dining Experiences: Where Flavor Meets Ambiance
Why Dining Experiences That Are Worth Traveling For are a Must-Have
Fine Dining Secrets Locals Swear By – Discover Hidden Gems & Tips
Budget Eats That Are Loved by Locals: Discover Affordable and Delicious Local Favorites
Why Ice Cream Shops That Are Worth Traveling For | Top Destinations
